CAZyme Information: MGYG000000967_01496

Basic Information

• Species: UMGS1441 sp900543365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; UMGS1441; UMGS1441 sp900543365
• CAZyme ID: MGYG000000967_01496
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37789.72	8.6591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000967	1698990	MAG	Spain	Europe

• Gene Location: Start: 122; End: 1120 Strand: +

Full Sequence      

MAYFFRAIIATFKVGKQDYVFSISQPPVLGGLLGVIGKFIKRAKFIYNIQDFNPEQIMAG
SYSKNKLILNLMMFFDKFCCKMSSKVIVVGRDMAETLKKRFKNKKIPNYAVINNWIDESE
IYPLDSNNENVLKFKNKYGLDNKYVIMYSGNIGLYYDLENIIKVIEKFPKGTKTNSGKEV
VFAFVGAGTVLDNLVEYKKKHNMDNVVFIPYQDKSDLIYSLNAGDVHWCVNAKGIKGVSC
PSKYYGIASCQKPVLGVLEEGSEIRCIIDETESGLCSEPEDYDSIENNIKWFIENADSKA
IEDMAKNGYNNLMKNLTRKVSVNKYKEEILNS

Enzyme Prediction     

No EC number prediction in MGYG000000967_01496.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	3.35e-59	3	326	85	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
PRK10307	PRK10307	5.30e-21	16	300	106	378	colanic acid biosynthesis glycosyltransferase WcaI.
COG0438	RfaB	1.42e-17	3	329	70	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	4.92e-10	2	325	64	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03795	GT4_WfcD-like	7.39e-05	71	318	123	351	Escherichia coli alpha-1,3-mannosyltransferase WfcD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP-linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU03773.1	2.19e-168	1	330	95	424
CBL24096.1	1.80e-166	1	330	91	420
QYH52198.1	3.79e-151	1	330	90	418
QSF28997.1	1.44e-148	1	332	96	421
QCY24111.1	1.44e-148	1	332	96	421

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KIU8	5.58e-23	4	281	82	347	Probable glycosyltransferase WbjE OS=Pseudomonas aeruginosa OX=287 GN=wbjE PE=3 SV=2
P32057	1.80e-10	43	290	131	372	Putative colanic acid biosynthesis glycosyl transferase WcaI OS=Escherichia coli (strain K12) OX=83333 GN=wcaI PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000967_01496.