CAZyme Information: MGYG000000968_00034

Basic Information

• Species: Veillonella_A seminalis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella_A; Veillonella_A seminalis
• CAZyme ID: MGYG000000968_00034
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190		21380.12	4.3762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000968	2145066	MAG	Spain	Europe

• Gene Location: Start: 35809; End: 36381 Strand: +

Full Sequence      

MKGSTFLAWCMIILGWYYFAVGEPYLARTYAYPLEHSATVYAAAQANKVPYSLVAGVILA
ESKFNEHAESAPGALGLMQLMPETAHWIAEQMNEPKLTDNDIKEPDTNIKLGTWYLAYLL
NEFKGNKVLALAAYNAGRGHVEEWMTQYGWGDDFDNIEDIPFAETREYVTAVLKNQEKYE
SLYAGDAAQQ

Enzyme Prediction     

No EC number prediction in MGYG000000968_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	181	1.4e-30	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.74e-76	33	178	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.56e-62	31	182	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.30e-36	52	177	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.21e-34	27	189	130	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	4.56e-31	42	154	3	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV63004.1	1.87e-66	1	186	1	183
BBU36008.1	5.33e-66	1	186	1	183
VEG93728.1	5.33e-66	1	186	1	183
CAB1276067.1	1.07e-65	1	186	1	183
ACZ24461.1	1.52e-65	1	186	1	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.45e-23	32	173	445	586	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.48e-23	32	173	474	615	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	3.67e-23	32	173	445	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	3.67e-23	32	173	446	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1SLY_A	5.12e-21	32	186	449	604	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	2.84e-20	32	186	476	631	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	2.84e-20	32	186	476	631	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	3.33e-19	32	173	476	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	7.02e-18	16	182	403	575	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O64046	1.81e-16	31	178	1417	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.764482	0.230313	0.003209	0.000290	0.000226	0.001479

TMHMM  Annotations     

start	end
5	22