CAZyme Information: MGYG000000968_00276

Basic Information

• Species: Veillonella_A seminalis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella_A; Veillonella_A seminalis
• CAZyme ID: MGYG000000968_00276
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		65667.42	8.0664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000968	2145066	MAG	Spain	Europe

• Gene Location: Start: 283184; End: 284947 Strand: -

Full Sequence      

MKQKVTRAVLAALLTFSVSGAYAASIEVTKENSTLIRIDNNIKSKATVPSATGQTAVTSE
IAGTGNVQPISFRTLAGQITDSGEMAIIEGSHMLIPLSVYQQVNLNPITRKDDNVYVTLP
APRRAGDMSYNGDRRNGERTIQLATIERYGVIYVDMSATSPLLGVQADRTKTGIELKAPL
GGLDIPARKEIKGSISWVFDPFVSKPYDTPVAKTGTSIVSPTWFDFSENGLAVKPGVSLT
YTNTYKDQGYRIWPLVTNKFDADFTSKVLNDKKYWKTIADDLVLYALSYGYDGYNLDIED
VHYKDRAKLTSFVAYLTQRLHEFNIFVSMDVTGYSDSENWSKVYDRKHLGEVLDYMVLMA
YDEVWASSPEAGPVASYPWVKRNTTALTREVSPEKIVLGVPYYMRVWQRTISVDDKGKVT
YGKPKSRTLTMSEAAELKTKYADRVTWDNDLKLNYVKFSNDELAEQFLTYAETGKEPRIV
AGLRNKSAVISEVWFEDEASMAYKRELMSELKLAGFAAWRKGFETEAFRQFMFNDNIQAD
KFKHDNIKKAGELPKIESKNTSLTKSETNTGTSPFGASSTVVVTKES

Enzyme Prediction     

No EC number prediction in MGYG000000968_00276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	265	532	4.6e-28	0.7364864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.32e-60	219	524	29	305	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.18e-35	184	528	101	414	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	3.62e-17	217	524	25	293	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	1.09e-14	266	519	83	329	Glyco_18 domain.
cd02876	GH18_SI-CLP	2.21e-14	201	462	11	275	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV65543.1	8.03e-102	91	527	26	429
BBU36194.1	1.47e-101	141	527	77	429
BBU34423.1	4.31e-101	141	527	77	429
ARF99299.1	6.45e-101	74	526	10	428
VEG93546.1	8.53e-101	141	527	77	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	5.23e-17	251	520	66	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	6.30e-14	246	528	63	331	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3K_A	1.42e-13	260	541	182	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	1.80e-12	224	522	141	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
6EPB_A	6.93e-06	276	413	148	303	Structureof Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31682	7.38e-19	217	407	27	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O05495	9.80e-17	251	520	158	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	5.53e-12	260	522	180	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.30e-11	260	522	180	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	2.29e-11	224	522	139	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.998958	0.000207	0.000197	0.000192	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000968_00276.