CAZyme Information: MGYG000000968_01411

Basic Information

• Species: Veillonella_A seminalis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella_A; Veillonella_A seminalis
• CAZyme ID: MGYG000000968_01411
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41740.58	9.7388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000968	2145066	MAG	Spain	Europe

• Gene Location: Start: 5409; End: 6518 Strand: -

Full Sequence      

MTKGPIGLLLPGLIVVLFLVSQRDYKELLHMKWLGGIAIFVLTAGPWYYYMYSVHGMDFI
DTFLGVHNVLRATVSEHPRDNVWYYYFGMFIIGFFPWVFTLPYLFKRRFQAQRQRLQTAM
ASGANIGVGGANKTDDNRFDSLVMNIGSVNSGGAVLHAQYATNSGSEGTAGWRATLRGMM
RFDQTTIFLLIWAFTIAVFYQLMATKYTTYTFPYLLPIAILAARVMVNHLKLVKYTVIAN
IVLYSVLTFAVAIPYCNAYSSKDVGNVVAQTVKPGDMVVSYGRYQTSAGFYSNQLIYRME
KAADIPGLEPSAMNWNTKNVMPFIAEETVATRDDVVAIVDNRRLKEFKADMPGQWQEVKA
LDKFTVFRK

Enzyme Prediction     

No EC number prediction in MGYG000000968_01411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	1	261	1.8e-43	0.3537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.92e-13	1	117	176	294	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.20e-09	1	115	178	290	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL22207.1	6.35e-76	1	367	198	518
AVO74995.1	2.00e-71	1	356	193	495
CCC74317.1	2.00e-71	1	356	193	495
AVO27725.1	1.10e-70	1	356	193	495
ALG42265.1	2.39e-70	1	356	183	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.84e-09	1	123	204	328	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCB9	5.39e-08	1	114	177	288	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
B4EUL1	2.23e-07	1	116	181	294	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
O67270	6.55e-07	1	116	171	281	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B2VBI7	5.02e-06	1	114	177	288	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
A8FRR0	6.61e-06	1	106	178	281	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999998	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	21
28	50
83	105
187	204
237	259