CAZyme Information: MGYG000000969_01733

Basic Information

• Species: Eubacterium_I sp900546495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_I; Eubacterium_I sp900546495
• CAZyme ID: MGYG000000969_01733
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000000969_34|CGC1	47449.11	4.449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000969	2650866	MAG	Spain	Europe

• Gene Location: Start: 16393; End: 17664 Strand: -

Full Sequence      

MANKGLHVQQTENVDRGRLQVNVTSTLGLQPVVNARVGIAYTGESQRPLEELQTDSSGQT
EAVTLDTPPMEYSQEPDQPQPFSEYTVTVQAEGYRSVEVSAIDVFANVTALQEIRMEPLD
ISKGEGTENIVVPPNTLWGDFPPKIPEEEVKPVNESGEIVLSRVVIPEYVIVHDGPPTDT
RAQDYYVRYRDYIKNVASSEIYSTWPDATLRANILAIMSFALNRVYTEWYRGKGYDFTIT
SSTAYDQKWSFGRTIFSNISRIVDEIFNHYLSRPNVQQPILTQYCDGKNVSCSGWMTQWG
SKYLGDQGYSPIEILRYYYGSSMYINSAEEIAGIPSSWPGTDLAVGSSGTKVRQIQQQLA
RISQAYPAIPTITADGIFGERTREAVEAFQRIFDLPVSGVVDFPTWYKISQIYVGVTRIA
ELN

Enzyme Prediction     

No EC number prediction in MGYG000000969_01733.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	2.46e-13	348	409	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	2.42e-09	339	411	117	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.19e-08	346	409	42	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	6.18e-06	181	319	106	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam08486	SpoIID	0.004	191	265	15	93	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV21206.1	7.79e-210	13	422	10	418
QEI32542.1	1.69e-197	10	423	17	430
QHB25032.1	1.69e-197	10	423	17	430
QRT31086.1	2.57e-197	10	423	19	432
AWY98201.1	1.64e-195	6	422	6	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000969_01733.