CAZyme Information: MGYG000000970_00720

Basic Information

• Species: UMGS1880 sp900555875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1880; UMGS1880 sp900555875
• CAZyme ID: MGYG000000970_00720
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890		98939	6.3985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000970	1325935	MAG	Australia	Oceania

• Gene Location: Start: 569; End: 3241 Strand: +

Full Sequence      

MKYQDLISKLTLEEKVALTSGKDFWQTVGIDRDDVKIPSMFLSDGPHGIRKQAAAADHLG
LNASIPATCFPTAATMANSWNDELGEEMGKMLGEEAVDERVNVLLGPGINIKRNPRCGRN
FEYFSEDPLLAGKMAAAYIRGIQSNGISACVKHFALNNQEERRMVIDTVTDERTMREIYL
TGFEIAVKEGNPLAVMSSYNMVNGTHTNENIHLMRDILRDEWGYKNVVVTDWAGCNDRIQ
GIIAGNELEMPSCLYSNDDLYKALTKGYDIPPELTPDRPGAQYERIMAALKDGKLDEKYL
DECLDRLLDLVFTTDKAFEGRDEDEKLAVRNVDAHHEMAKKCAEECIVLLRNENNTLPLA
GGTKVAVIGDFAKVPRYQGAGSSVVNPTKLDSPLACLGFKIDKYEKNPLPCEQDKIVGIG
DNVYGLDVVGYEPGFDRYGKKKPALIKKAVALAKKADVALVYVGLDEVTEAEGLDRKNID
IPQPQIDLIDALCASGVKTVVVLSCGSSVELPFADKVDALVHAYLGGQAIANAVLDVIVG
NVNPSGKLAESYPFKYADCSSASHFPGKQLSVEYREGLYVGYRYYDTAKVPVRYPFGFGM
SYTTYEYGDLEVTDKGVSFTIKNTGDRDGKEIAQLYVGLKGGKIFRPAKELKGFKKVFVK
AGETVKVSIPFDERTFRYFNVSTDKWEVESGEYDIMIGASVEDIRLFGKLDVKGTTTVDP
YAGVALDSYRSGNAENVGLEEFTALLQCGADKYKYPVPDPGYKFYKKKRMVIHYNCTVAD
LRYSRRWFGRLFSGAIRFARALLWKMGNRTLSNTLEMGVVHQPIRGMAKFGGMNRARMDG
LILMCNGHFFKGLGQLRRGKTKEEAREEKQMRKNRESDLAAQDKINKDAE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	251	1.5e-64	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.39e-85	5	698	40	751	beta-glucosidase BglX.
COG1472	BglX	9.46e-67	22	375	47	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	9.08e-52	347	582	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	2.50e-45	4	672	54	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.47e-35	26	310	55	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEU80235.1	0.0	1	862	1	802
AZK48658.1	0.0	1	852	1	788
AOZ92944.1	0.0	1	862	1	797
QOY35244.1	0.0	1	862	1	797
AST96263.1	0.0	1	862	1	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.13e-200	6	718	8	674	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.73e-176	7	714	9	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.83e-141	2	712	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.36e-140	2	712	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.56e-112	4	704	7	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.72e-199	6	718	8	674	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.66e-168	7	749	9	707	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.03e-166	7	759	9	717	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BFG8	4.46e-127	4	712	12	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
A7LXS8	1.09e-119	1	705	44	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000970_00720.