CAZyme Information: MGYG000000970_00781

Basic Information

• Species: UMGS1880 sp900555875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1880; UMGS1880 sp900555875
• CAZyme ID: MGYG000000970_00781
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000000970_93|CGC1	58191.84	7.6542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000970	1325935	MAG	Australia	Oceania

• Gene Location: Start: 2911; End: 4464 Strand: -

Full Sequence      

MATKKTESAKTAEGKPAAKKTAAKKSASGSGKKAARKVPAKPRILLVAGECNPFSQTGGL
GEVASSLPIAVNELGTAEMAVVTPLYECVGEQYRKDFKFVCHINVPVAWRSQYAGLFKYV
YRGVTYYFIDNEYYFKRAGLYGYYDDAERFAFFCRAVLELMPYMDFKPDVIHSNDWHIAL
VPIYYKLYYMYAEGTAYSYIQNLITIHNIEYQGRYDGNLLEEVFGIAGNQYFTLEWGGCV
NLMFGAMAYSDRISTVSRTYAEELKSPEHACGLQDAVKRFEGKMTGILNGIDTVVYNPAT
ALSLFEHYDADHPEKKVLNKTGLQKLIGLPEREDVPMITMVSRLAWHKGLDILKQAMPRI
VKEDVQFVILGTGEPEYEGFFHDLQNTYPDKVRAIIAFNKDMSQKLFAAGDLYMMPSHSE
PCGLGQMMAMRYGTIPIVRNVGGLNDTVREGEDGNGFVCPVHTGEALADTTLRALAAYRD
KPRWQAIMRRAMTEDWSWSASAKKYIELYKDMIAKAK

Enzyme Prediction     

No EC number prediction in MGYG000000970_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	43	510	8.3e-165	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	43	511	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	0.0	43	510	2	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	43	515	2	466	glycogen synthase GlgA.
COG0297	GlgA	7.34e-169	43	517	2	483	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	2.50e-102	43	514	5	481	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18264.1	2.02e-157	43	513	2	472
ARP51332.1	2.87e-157	43	513	2	472
QKN23272.1	2.87e-157	43	513	2	472
QKO30046.1	2.87e-157	43	513	2	472
QNK41915.1	1.26e-153	43	513	2	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	1.08e-88	44	509	127	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	2.64e-73	43	509	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.25e-72	43	509	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
6GNE_A	3.10e-72	44	517	12	502	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3COP_A	9.50e-72	43	509	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q72YJ6	1.26e-141	44	513	3	475	Glycogen synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgA PE=3 SV=1
Q6HC18	2.52e-141	44	513	3	475	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
B9J2G5	2.87e-140	44	513	3	475	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1
Q81K85	5.75e-140	44	513	3	475	Glycogen synthase OS=Bacillus anthracis OX=1392 GN=glgA PE=3 SV=1
Q632H4	5.75e-140	44	513	3	475	Glycogen synthase OS=Bacillus cereus (strain ZK / E33L) OX=288681 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000970_00781.