CAZyme Information: MGYG000000971_00363

Basic Information

• Species: UMGS1518 sp900552575
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; UMGS1518; UMGS1518 sp900552575
• CAZyme ID: MGYG000000971_00363
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		58591.44	6.0625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000971	3501016	MAG	Australia	Oceania

• Gene Location: Start: 6247; End: 7785 Strand: +

Full Sequence      

MKPKNFDIRNTGWRRELPQPIFDECPAYLDFYQRAWELAHDHVKAIPGMPQTPYMDEAFL
DSDIWIWDSCFMMFFCKYAANVFPGIETLNNFYQPLYDGVPLPKIVTRNPPDWSGCHDGE
TVPVRIHISDNPPLFAWAEYSYALMTGDRAHLERLLLEKQYLQKHFAFFDSLTEPGVQTP
FTRARTCLVKRENGYFWEGGRSGMDNTPRGRTGRRAETERPNHPRMLWVDAIAQQGLAAH
RIARIAELIDRPELAAEWQGKFEAIKAKLNCHYWDDADGIYYDINGDTQEKIKCLTPASF
WPLLSGIPAPEAVDRMCRYLTDPAKLGGPVPWVTVARDDADFNAETGDYWRGSIWLPTAY
MGIKGLENYGKFDLANATARRILDHMYRTYRDYEPHTVWECYHPNLPKPAQHGTELVRPD
FCGWSALGPIALFLENVIGIYQANAFTDTIDWALPPRIAGRLGIANYSFGDTVTELVYQD
GRIRTSSNRPYRLNVAGRTLPVPAGEAQFTVV

Enzyme Prediction     

No EC number prediction in MGYG000000971_00363.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	52	427	1.5e-19	0.3719298245614035

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.75e-16	240	385	589	742	alpha-glucosidase; Provisional
COG1626	TreA	7.30e-14	242	425	367	541	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	1.67e-12	128	440	337	610	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.09e-11	242	403	318	474	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PRK13270	treF	9.57e-11	242	403	362	512	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	1.48e-226	1	508	84	592
QZT38129.1	7.59e-181	18	511	33	502
AOW82330.1	1.05e-156	12	511	40	514
AHF90735.1	1.47e-149	5	511	16	511
QWO96172.1	1.35e-148	7	507	35	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.27e-11	240	412	562	748	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	1.27e-11	240	412	562	748	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	1.27e-11	240	412	562	748	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.38e-11	240	412	111	297	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.38e-11	240	412	111	297	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	2.77e-30	69	505	59	465	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	7.06e-11	240	412	585	771	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000971_00363.