CAZyme Information: MGYG000000971_01057

Basic Information

• Species: UMGS1518 sp900552575
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; UMGS1518; UMGS1518 sp900552575
• CAZyme ID: MGYG000000971_01057
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1076		120513.15	4.8081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000971	3501016	MAG	Australia	Oceania

• Gene Location: Start: 8725; End: 11955 Strand: +

Full Sequence      

MKKILWSGVTLLVSAGMAVASLAANEADGRFAETVLSDWENDRLSIAGEWSVTLPDDPVL
YPVQLPGSLDEAGVGTPLEKPERGALSRYVRYIGPAVYRREINIPENLAGRELELFLERV
LWQSQVKIDGRLLPEPRQSLATPHIHRLGKLAAGRHTLELIIDNSMIYRLGNHAHAYGES
MQTIWNGAVGTLEIRPADPIAELRIDAAFPAEALDIRFRGPAGRYLVQLTPRNFAGEAYQ
AILASVAAEDGRQLLHLPFPDTKPQAWSEFAPCLYDLTAVRLDRDGAPAVIAEEVGFRTV
RREGNRLFLNDRPLFLRGNLDNCHFPLTGYPAMDKASWLRLMRISRENGINNIRFHSWCP
PRAAFEAADEVGVYLEPEVNLWIDGWMGDENGRPLTGIGREDRDLNRFIRQELHDIIAVY
GNLPSLTMLEFGNELGSADFDVLGQWLNEIKQQDRRRLYSASTARSISGADDYLVTHDYP
DVGGTRGRMSAGTAWNYEDIYGRTQLPTIAHEIGQWPVYPDYREIDLYTGVLHSTALETS
RRQAEEAGVLRFNREYAFASGMQSKMMYKDEIEAFLRTPSCAGLQLLGMQDYSGQGEALI
GWLDSFYRNKGVLPPEEVRSFLAPTAVYAEFAKYVWTATETPEIGLVIHHYGENDLRDGR
IAVTLRSADGSTVREELMTIGGIPVGTVKKAGAVRLPLNDLTSGRYELTAEVLDGERPVS
GPNCWPLWVLPQEITVACPANVVFTDKSEEALRALASGQNVVLDAHALGVRPDYLPADWG
SVYWSTSWFSGQARRTLGLWLEEDSPVFMHFGAQGFGDWIWFRLAENGRAFKLTGLPADY
CPIAMPVPDFHFNQLLGTIFAVKVGEGKLLVSGYDLSREWPETRQLKANLLAWAGASGFE
PAAEVSADWVRQLFRTLDTAALPRPEEFRQAAVYLEPAARLTEMGRDVNWEAKFDRADLA
DDCSYEVRNVSLWADSDGQYWVLQPNSLITLKFPSGETGRLLVRFRDPNRNNRSGEGVFE
GRPFSVPVHQDNPAGVYWLELRVDREDSLDGELNFQVTPQSGPNLMIDRFIYLPNR

Enzyme Prediction     

No EC number prediction in MGYG000000971_01057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	37	678	2.4e-45	0.6781914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.75e-12	237	436	222	408	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	8.13e-10	259	436	278	451	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAX78846.1	1.36e-255	40	1073	29	1080
QTE22603.1	2.66e-241	44	1071	24	1062
QOD61956.1	5.90e-240	44	1071	24	1062
QQT78362.1	2.23e-235	38	1073	46	1094
QRP56393.1	2.23e-235	38	1073	46	1094

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NCW_A	1.38e-10	78	437	35	381	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
6D89_A	1.36e-07	262	462	259	443	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	1.38e-07	262	462	267	451	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
6XXW_A	1.61e-06	264	456	250	437	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.068622	0.921666	0.008365	0.000591	0.000352	0.000368

TMHMM  Annotations     

start	end
5	24