CAZyme Information: MGYG000000971_01811

Basic Information

• Species: UMGS1518 sp900552575
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; UMGS1518; UMGS1518 sp900552575
• CAZyme ID: MGYG000000971_01811
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		70489.87	4.8472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000971	3501016	MAG	Australia	Oceania

• Gene Location: Start: 2124; End: 3974 Strand: +

Full Sequence      

MLLPISFSEYEAQVSLPWGAQTRLCVGDSAAGELLTAARPAADRGEGGLREICFEEIPPQ
SISRQFGSDSEASEQYAILIVRERIAVQAASRPAMLYAAETLLQLLDDNGCFPVGRFYDV
PQCPVRGLKLMLPAADKMADFKRLIDLAAAMKYNTVMLEIGGAMEYRRHPEINEGWLEYC
AFMNEYPGKGQEIQEKTAWERNSIHSDNGGGGCLTQAQVKELAAYCRDRHFQVIPEVPLL
SHCDYLLTRHPELAERAEDPWPDTYCPSNPASYELAFDVLDEIIEVFRPEIINIGHDEYY
TIGLCERCRNRQAPDIYAEDIRKIHDYLADRRVKTMLWGEKLLPARLKDGYAVGGSECGW
RSKIPATWTAIDQVPKDLLVSHWYWGIDRKLEQYYIDRNLAYVFGNFEPAVFPDFNRRVA
QPSCRGGIISNWGRTDLLTMQRNLILFNMAYGAFRFWLYSFEMWSNEEQLQAVFAYLYHL
NPAAAAGENKLTLEHYTTRLFQWGFFYDGKYIKPEEYCLGSYLVTFRDGSHCELPVCYGQ
NIGSGDVAWTRQEADNMDTWRFDESLPELSYSTLPVKADGVTFYRTDFQLPQPASEVSAV
EFRPKGDSIRVVFRRR

Enzyme Prediction     

No EC number prediction in MGYG000000971_01811.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	138	383	4e-37	0.6112759643916914

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	3.32e-33	134	439	12	283	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	1.23e-21	124	433	1	296	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	1.78e-21	138	340	17	226	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	3.56e-19	139	329	18	199	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.09e-17	54	363	184	512	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN43054.1	1.60e-160	50	611	52	642
SDT51451.1	1.82e-159	62	607	64	614
AOS71572.1	1.88e-159	38	613	49	645
ALD72383.1	1.88e-159	38	613	49	645
ABN44552.1	5.30e-159	38	613	49	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PYS_A	2.08e-14	39	353	32	352	Thecrystal structure of beta-N-acetylhexosaminidase from Bacteroides fragilis NCTC 9343 [Bacteroides fragilis NCTC 9343],4PYS_B The crystal structure of beta-N-acetylhexosaminidase from Bacteroides fragilis NCTC 9343 [Bacteroides fragilis NCTC 9343]
6JE8_A	4.29e-14	65	313	24	278	crystalstructure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEA_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEB_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
6Q63_A	2.22e-13	67	363	99	408	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
6Z14_JJJ	2.54e-13	72	383	257	578	ChainJJJ, Beta-N-acetylhexosaminidase [Bifidobacterium bifidum]
3RCN_A	2.86e-13	79	361	82	383	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UP57	2.55e-13	65	313	45	299	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
B2UQG6	3.18e-10	74	365	97	398	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	4.58e-10	76	336	210	477	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000971_01811.