CAZyme Information: MGYG000000972_00135

Basic Information

• Species: UMGS1491 sp900552265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1491; UMGS1491 sp900552265
• CAZyme ID: MGYG000000972_00135
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		53604.63	9.736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000972	1119698	MAG	Australia	Oceania

• Gene Location: Start: 135996; End: 137420 Strand: -

Full Sequence      

MSYIKLKNKIVKIFIVMAAVILSEFSGKICLASGDIPRDYYALPVGKSVLMNRTSTPDQY
LEWKSEDTNIAVVDSWGVVHAKSIGKTNIIAVDKRNKKRSSCCLEVKESEPFKNVITSLN
IAGINESFDIKAYATKNVSEVKFNIQASGYNQTIQCKNKRDEKNFCIWTQSVKIPKCGKC
KIEALGKINGSWKSCHEGIFEIYISNEYKNQDSNLSEKRVSSKGSDFIVSCEGFVSKVYK
DRAGILTIGCGKKIHPFEPFYDNLSWEEGAALASRFLSCGNCTKLINKFLMQNNIKCRQN
QFDALVSFSYNLGSSWAFKSGNELRNILLDCARGGAERPYGIVNSGNGLYVRSSPSTSSK
KLCALINNSRVELLDKNKKNGKWYHVRTQNGIVGYCFGDYLKVYSEKSGEKNLDNVDRNR
FISEFLRYHHVKKKCNQGLLKRRCEELDIFFRSIYSRNTGLRGVGNYPIPRCML

Enzyme Prediction     

No EC number prediction in MGYG000000972_00135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	220	321	1.1e-17	0.708029197080292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	4.20e-16	226	327	3	98	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam08239	SH3_3	6.15e-13	348	402	2	54	Bacterial SH3 domain.
cd16901	lyz_P1	6.35e-09	219	319	1	94	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.26e-08	219	327	6	109	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
pfam02368	Big_2	6.66e-06	42	95	11	68	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZT89632.1	2.60e-13	204	337	88	231
AWB43148.1	7.26e-13	209	329	484	601
ADX66822.1	6.86e-11	219	327	2	108
VEH63454.1	6.86e-11	219	327	2	108
ADL41706.1	1.80e-10	209	337	94	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.45e-06	218	338	50	167	ChainA, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.604837	0.356265	0.035314	0.000726	0.000517	0.002328

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000972_00135.