CAZyme Information: MGYG000000973_00907

Basic Information

• Species: UMGS1490 sp900552245
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900552245
• CAZyme ID: MGYG000000973_00907
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000000973_45|CGC1	39646.14	10.2044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000973	2116765	MAG	Australia	Oceania

• Gene Location: Start: 3278; End: 4375 Strand: -

Full Sequence      

MSNFLISCGGTGGHLSPGIAVGEALIKKGHNVSFIISEKAIDSKLVKKYSDFKFEKTPGC
GFALNPARLAKFIITQARAVKICKKLIRENKADAAIAFGGFNSFGLAMAAILTKTPLVMH
EANRKAGKAVRLFGKFAKRVYLPYGVKISKRNSDRIKHAGYPIREEIQKLDAKASKEFFG
FSPSANVILVCGGSQGAAALNEWAVKNFASLAREGFDMLCITGPGKPANPPKSCKDKNGS
VREFKALEFCDNMARAMSSASFVVARAGAGSIAEFARCRLIPILVPYPFSADNHQVENAR
FVEKSAAGICVLQSNIDTLENEILELASNEQLREKMRKNLELIDQSNSISKMISDIEQIA
KFKGI

Enzyme Prediction     

No EC number prediction in MGYG000000973_00907.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	342	1e-38	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	3.07e-94	4	353	2	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	4.50e-89	1	361	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	9.41e-72	4	356	3	347	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	3.00e-71	5	362	4	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	8.76e-29	1	359	1	352	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35776.1	7.49e-104	1	360	1	360
QYM78081.1	2.21e-102	1	359	1	359
AWT60195.1	5.97e-95	1	360	1	361
AWI07981.1	1.63e-94	4	359	13	368
AOS46406.1	1.98e-93	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.78e-24	5	359	13	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	5.11e-22	3	320	4	313	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	9.84e-20	5	323	10	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1ZU31	6.14e-93	1	364	1	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) OX=452637 GN=murG PE=3 SV=1
A0Q766	7.90e-40	3	363	7	371	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Francisella tularensis subsp. novicida (strain U112) OX=401614 GN=murG PE=3 SV=1
B8CWJ6	2.99e-39	9	361	8	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=murG PE=3 SV=1
Q14I26	1.13e-38	3	363	7	371	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) OX=393115 GN=murG PE=3 SV=1
Q5NGM4	1.13e-38	3	363	7	371	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) OX=177416 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000973_00907.