CAZyme Information: MGYG000000975_01215

Basic Information

• Species: UBA4855 sp900545015
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; UBA4855; UBA4855 sp900545015
• CAZyme ID: MGYG000000975_01215
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		60163.7	8.7144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000975	1556359	MAG	Australia	Oceania

• Gene Location: Start: 6394; End: 7968 Strand: +

Full Sequence      

MKKKPTLYIVILCVWVLCLSVLGVSLYFILTNLQIENLAAEITASILLTLNTLVLGILWF
GSLKDLIFSIAFATTGKKMLSRYKDIYETKVDEDYNPKFLLLYCTRNDFNRDALLKCMAQ
KYKNVKTVILDDSDDEEYLNEIDLFANEFDVEVVRRKEKTGFKAGNLNNYLRNRNDYDYF
VVLDSDEVIPCDYINKVLKYFTYDKKCGAVQARHKATKGNNVFQRLMGLSVGSNGASTQV
VKNFYGSNALIGHGMTISRECYLKTGGFPLVVAEDISFAVDIRNNGFDIIYAPEIECYEE
FPVNYLSLKKRQCKWTQGNLEYMRKYNSEITNCKMSWFEKLDLIISHYSLPIVPVLSFFL
IFFTITLGFLGVNVIHYSIFIYTLMIIFLCSPLIPDIFVYRKDRNFFLILPYFILNIVTY
ASLAPMMISTVFLGLFGKKATFLVTPKNNETFTFGRAVRGTLDSLIFSIILTVFSLIACQ
NILPVLLVFIGCLCAPFVVMLSNIEIKDNSKNKLRERAKRRFSK

Enzyme Prediction     

No EC number prediction in MGYG000000975_01215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	114	305	7.5e-23	0.8521739130434782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.26e-20	48	428	4	396	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	2.31e-16	111	321	18	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13641	Glyco_tranf_2_3	2.54e-16	97	313	2	224	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06437	CESA_CaSu_A2	6.03e-16	129	318	37	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
COG2943	MdoH	3.95e-13	129	489	184	528	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN47592.1	1.01e-153	31	522	38	524
QIN45523.1	1.01e-153	31	522	38	524
QIN42096.1	1.01e-153	31	522	38	524
ABC01535.1	1.43e-153	41	522	45	524
QDL20008.1	1.43e-153	31	522	38	524

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3D3U0	2.17e-10	155	324	206	389	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=opgH PE=3 SV=1
A6WMM7	2.17e-10	155	324	206	389	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS185) OX=402882 GN=opgH PE=3 SV=1
A9KZ13	2.17e-10	155	324	206	389	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS195) OX=399599 GN=opgH PE=3 SV=1
B8E7D2	2.17e-10	155	324	206	389	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS223) OX=407976 GN=opgH PE=3 SV=1
Q0HJ63	3.78e-10	155	324	206	389	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-4) OX=60480 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
39	61
350	372
377	399
406	428
482	504