CAZyme Information: MGYG000000976_00066

Basic Information

• Species: CAG-492 sp900557195
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492; CAG-492 sp900557195
• CAZyme ID: MGYG000000976_00066
• CAZy Family: GH18
• CAZyme Description: Putative sporulation-specific glycosylase YdhD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		29005.89	4.3773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000976	1832180	MAG	Australia	Oceania

• Gene Location: Start: 62768; End: 63514 Strand: -

Full Sequence      

MKETTSEIMKDYKLREKLINQIVDKVKKYNLDGINIDFEYMKEEDRDLFSRFIIELTPRI
KELGKVVSVDVTAPDGSPDWSLCFNRNVLGDVADYIMFMAYDQHGEYANEEGEEGTVAGF
DWVELNINKFIGKQEEVPAEKLVLGMPFYTRLWKVKNGEVTSSVVTMKNVEKSIPEGVTK
EWDEILKQNYIQYEKDGAIYKMWIEDEDSIKEKLSLVNKYNLAGSSYWVKDFENENIWNI
IKQELNNE

Enzyme Prediction     

No EC number prediction in MGYG000000976_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	6	234	2.7e-41	0.7094594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.22e-61	2	241	75	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.99e-42	3	246	180	423	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	5.98e-29	6	228	80	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	8.34e-27	6	228	83	329	Glyco_18 domain.
cd06549	GH18_trifunctional	5.08e-23	8	238	82	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXM06578.1	2.54e-63	5	246	309	552
QZY55662.1	2.08e-61	3	246	307	552
QEK11369.1	1.75e-59	5	245	310	552
CDZ75052.1	3.18e-59	3	245	308	545
AUS98160.1	8.06e-59	3	245	319	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	5.92e-23	3	228	84	306	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	1.81e-18	33	245	107	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	4.90e-17	3	245	185	427	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	3.49e-15	3	228	184	408	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4WIW_A	1.16e-14	4	236	86	335	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	9.16e-28	3	243	104	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	1.03e-22	3	228	176	398	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	3.51e-18	8	246	186	424	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O31682	2.82e-16	18	153	85	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P0DPJ9	1.40e-14	3	228	183	407	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000976_00066.