CAZyme Information: MGYG000000976_01176

Basic Information

• Species: CAG-492 sp900557195
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492; CAG-492 sp900557195
• CAZyme ID: MGYG000000976_01176
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42264.88	5.0506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000976	1832180	MAG	Australia	Oceania

• Gene Location: Start: 50680; End: 51786 Strand: -

Full Sequence      

MKKKRIIVIIASVLIILITIFGAIFIKTKQSNDENIIKDEEIEVNNINNTNISTNIIDNS
EINEQKIVNKTQTPIQKYGKLKVEGAKLVSENGNTVQLKGISTHGIEWFPQYINKDSFKF
MRDEWNIDLIRLAIYSEGYNENQNKIIEDGIDYATDLGMYVIVDWHILNDNNPNINKEKA
RVFFSYIANKYKNNVNIIYEICNEPNGNVTWEKDIKPYAEDMITLIHGINEDSVILCGTP
QYCQKINEVTKSPITGHKNIMYTLHFYASTHKQELRNELSNAIEKDLPIFVSEFGISEAS
GNGSINIDEANKWMDLLNSNNISFIYWNLSNKNESTALLKNSTSKFNNWNIEELSDAGKW
FISILNDK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	91	324	1.2e-86	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.99e-63	89	333	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.81e-12	92	368	58	389	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam13204	DUF4038	0.003	151	208	90	154	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA47670.1	3.66e-108	66	365	185	498
QBR94633.1	5.37e-105	79	366	92	387
QNM00780.1	2.01e-102	73	360	213	507
QNM02472.1	2.17e-101	73	360	86	379
QWT53734.1	4.50e-101	64	360	204	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.73e-99	73	360	5	295	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	2.16e-98	71	358	27	317	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	1.26e-96	71	360	2	297	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	5.45e-93	72	360	3	298	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1LF1_A	1.80e-81	75	358	6	293	CrystalStructure of Cel5 from Alkalophilic Bacillus sp. [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	2.20e-95	71	358	32	322	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	3.10e-95	71	358	32	322	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	2.17e-92	71	358	32	322	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P15704	4.01e-86	79	358	45	328	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P22541	1.31e-85	78	362	113	404	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.774039	0.211648	0.011624	0.000830	0.000396	0.001468

TMHMM  Annotations     

start	end
7	26