CAZyme Information: MGYG000000977_00781

Basic Information

• Species: Clostridium sp900539375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900539375
• CAZyme ID: MGYG000000977_00781
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	MGYG000000977_6|CGC2	82865.29	9.1142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000977	2927434	MAG	Australia	Oceania

• Gene Location: Start: 42687; End: 44813 Strand: -

Full Sequence      

MNSIRYCIDDIEKKGTDIIIVGWAYSEKDKKVNINIKDMDNIDIKVVQRVDIFHAYHQRQ
EALNSGFKIKIPFTKKVTMIFTTDDEKLVCKFNTKRKPKPQRISKIKILTLHILSIINPI
RIIRLLIGIPYKFVRFIKFLNKNGIKKTLLKIHSKINKRKLDGIGYDNWFRRQLITPKGA
EIQKRFQFKYSPTISLVISEISEEGRYIDKLIESILKQTYINWELFIPAKDIQEKKLIEK
LKNYSNKENKINIDFETDNVNELLKKTTGDFISLLNSNDLLTIDALFEMVKVINENSKID
FIYSDEDKINEDESEYFDPNFKPDWSPDTFRCYNYINNLTAFSKKLLNKAGYLNNKYGKD
KEYDIYLRLTEQANEIYHIPRVLYHNRINETKEEVLDTNYGKEIIEEHLKRIGLEGKVSN
GLIAKTYKINYKINGNPKVSIIIPNKDEVDTLRTCINSILNKSTYNNYEIIIVENNSISK
EIFNYYEEIKKIDNIKVVKWKNGFNYSAINNFGFKETKGDYIILLNNDIEVISENWIEEM
LMYAQREDVGIVGAKLYYPDNTIQHAGVILGIGGVAGHSHANFQRDDNGFAGRLKIVQNL
SAVTAACLMIKRSVYEEINGLNEDLAVAFNDIDFCLKVRKKGYLIVFSPYVEMYHYESKS
RGKDDTKEKSARFESEIKTFHNKWGLWIRDPYYNDNLTLDKEDFSLRI

Enzyme Prediction     

No EC number prediction in MGYG000000977_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	440	618	1.9e-26	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.88e-58	192	388	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.11e-38	441	657	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.32e-29	435	663	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	8.36e-23	440	615	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	2.96e-20	438	656	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE14040.1	2.33e-187	131	705	371	958
AWB09765.1	4.18e-187	130	705	148	758
CDM69534.1	2.74e-178	138	707	191	772
BAV13183.1	3.70e-174	130	706	194	795
ADL50381.1	3.70e-174	130	706	194	795

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.21e-114	171	706	347	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.35e-74	192	707	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000977_00781.