CAZyme Information: MGYG000000982_00625

Basic Information

• Species: CAG-354 sp900552655
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-354; CAG-354 sp900552655
• CAZyme ID: MGYG000000982_00625
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		45900.05	5.1445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000982	1595406	MAG	Denmark	Europe

• Gene Location: Start: 18222; End: 19433 Strand: -

Full Sequence      

MGIRTKFSDDLLWLPYAVLEYIRITGDKDILNIETNYIEGEILKEDELERYSLYNTSKTK
GTIYEHCKKAIERACKFGVNGLPKIGSGDWNDGFSNIGPKGEGESVWLAFFLYDILNKWV
NEIKIDEDEKYIEILEGLKRNINKNAWDGNWFKRAFMDDGTPIGSMENEECRIDGISQSW
GVISGAADNDKKFISMNSLETHLIDKENGLIKLLDPPFENGRIEPGYIKSYLPGVRENGG
QYTHGAVWAIIAEALLGFGDKASEMFKIINPIEHTRTKESTNKYKVEPYVLSADVYSSKN
LAGRGGWTWYTGSSGWLYTAGIEYILGLKISNNYLSINPCISKDWKEYKINYKYKSTIYH
INVKNPEGKNTGVTKVYCNGNEVFEKKIKLIDDGEIYNIDVIM

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	2	400	7.2e-158	0.3735521235521235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	1.16e-131	2	368	662	1022	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.01e-97	2	329	98	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3408	GDB1	3.25e-04	9	362	339	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV69563.1	5.23e-158	2	403	2514	2919
QCX34529.1	1.02e-151	2	403	2305	2710
QXM05338.1	1.25e-150	2	403	2440	2845
AIS53008.1	1.49e-149	2	403	2481	2886
QZY55792.1	1.29e-148	2	403	2440	2845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	4.57e-54	3	403	409	810	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
1V7V_A	1.25e-47	2	380	419	778	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
2CQS_A	3.42e-35	3	365	436	805	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	8.44e-35	3	365	436	805	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
4ZLE_A	1.97e-34	8	403	404	784	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	1.27e-103	2	363	2439	2805	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	1.98e-50	7	403	414	812	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q9F8X1	3.50e-47	2	383	419	781	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q76IQ9	6.59e-47	2	380	419	778	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000982_00625.