CAZyme Information: MGYG000000989_01225

Basic Information

• Species: Niameybacter sp900549765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900549765
• CAZyme ID: MGYG000000989_01225
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		96452.67	4.8013

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000989	3436851	MAG	Denmark	Europe

• Gene Location: Start: 18319; End: 20910 Strand: +

Full Sequence      

MIQYPFQDSTLHIEARIQDLISRMTLEEKVRQLDIYSNNEFKDDKDDFDFDKLMEVCGDV
GIGCLQNRYSSAHLNNKIQKAALEASRLPIPILFSEEALHGLIWPECTVFPQQIALASTF
SPELGFRQGHAIARECRSLGVHETWSPVLDLARDPRWGRVEEAYGEDTYLASRFAEEMVR
GLQGDDLSRNDTIIAEVKHFSGYGAPTGGLNCAPAMMGKHEHEFYCLPVFEAAFKAGALN
TMCSYNSIDGIPVAGDRHLLTDVLRGDFGMRGFVRADMTAITMLHRCHYVAPTQREAIRM
AIEAGVDMQLYDFSHDFYQDTLISLVKEGELKEEVVDLSVSRVLRAKFMLGLFENPYTDE
ALSKSVVHCQEHVDLALEVAEKAICLLKNAHHTLPLKKDLKTIAVIGPSAAVPRFGDYSA
PTKSCLGAVTLLDGIQAVVSEDTKVLYAKGCDILEFETMPIPATWLKDHKGNPGLKAEYF
NAHNFEGEPIVIRNDTQINFNWIYTKPAEGVNADRFAVRWTGVLAPTQTFEGSIGLSSMD
SMRLWINEELVVDGWGDKEATTMKPFFFEAGKEYNVQIEFINDQRGVRVIFGYNMGNDDM
EQAVLVAKQADVAIVAVGDSEETCGENLDRADLNLPGRQLELVKKIYETGTPVVLVLQNG
RPLSITWEAEHLPAIIEAWHIGEQGGHALAKVLFGDTNPAGRLPISFPKSVGQIPVHYNR
RPFGATKYVEMDWNPLYPFGFGLSYTNFEYSNLKLSSDTITADEILEVSIDVTNTGTCYG
EDVPQLYIHDKFSSVVRPYKELAGFERIGLDSGQTKTVTFKLGERQLRVLNPKFEWLVES
GEFEVMVGAHSQDLPLKATFCVK

Enzyme Prediction     

No EC number prediction in MGYG000000989_01225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	84	310	7.1e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	14	853	35	756	beta-glucosidase BglX.
COG1472	BglX	3.27e-84	75	420	45	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.47e-72	4	848	40	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.71e-65	25	346	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.86e-57	384	745	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98992.1	0.0	4	862	9	869
BBI31696.1	5.75e-318	6	860	11	877
QAY68112.1	5.18e-317	13	862	16	876
APA00260.1	4.02e-269	5	862	30	884
AXP81467.1	1.25e-266	5	862	25	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.68e-136	7	863	4	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.47e-135	7	863	4	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	3.60e-132	6	854	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	2.25e-131	6	863	7	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.72e-130	6	863	7	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.50e-132	14	851	35	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	7.10e-132	70	857	42	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	9.41e-130	14	851	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	2.03e-124	6	863	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P27034	6.67e-93	110	854	61	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000989_01225.