CAZyme Information: MGYG000000990_01429

Basic Information

• Species: Blautia sp900539145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900539145
• CAZyme ID: MGYG000000990_01429
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1903	MGYG000000990_23|CGC1	212588.8	4.4514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000990	2534213	MAG	Denmark	Europe

• Gene Location: Start: 3590; End: 9301 Strand: -

Full Sequence      

MKRWKQVCSTMLAGTMLIQTPVGAAPVPEAEQEEKSPWVSDWKPEDGTTTGDAYQIYPVP
QKIEYPSKTEFDMDKNVGVVSGEKVDKATNDYLNEVLEDFDRTPKKEKKAGDGSDIIIGV
KGSGDEADKYFADKKLDEKLFEQSGGYALSADGEDIIILGKDTEAAFYGVATLKMMFSSF
NGEKFYPVEIQDYASIDARGYIEGFYGSWTHEQRKSLMEFTRDVKMNLYVYASKTDAYHT
SKWAELYPDDILNQFKELVALQEKNKTEFSWAVHIGDMLRGLQDNQEEEYQARKKKLMAK
FDQLYDIGVRRFCILNDDFGAGSPELVVRLVNELNEEYIKAKGCKPIIYCPQGYNVAWSQ
GASGQKELETLKKFDKDVLIFWTGQDVNSPFTQESITYAKEKTGHSPVFWVNYPCNEHAK
SGIFLGSSAHYIRDNITGLAGAVSNPIHFAEADKVALFQLASYFWNVNDYSKHTEEVWEQ
CFKYLQPEVYDAYLTIARNVSNCPGSGRVPKGFEESLYLAETLDTIQKAVQGNTFTADMQ
EVKNLKAEFAHIRDAIKTFTENCTNKALVQELTNPGNREGGEGWLQALENVVKAGEYILQ
AQEEMAKAEPDMGIVWQNFSDASAEMNTYNKRTYQFPAGGTQSVKAGSRRLVPFVNACME
DVKAVVDELLATGNAETPADRIYTNVSKYAKTPLTIDEKEYGVRNVKVTLEKNQYIGIKT
KEIAEISKVILEGSDVSGLTLEYALYGDDWKEVEPGDLQKNIEARYLRLVNKGEKPVTAM
VKKLAAVIENRAVSMSVKGTNIKELQSGSWDEMFDGNAETFALTKGAQKTGDYITVDLGR
TQAINDITFWTADGDQKIYDAKVSVSKNNKDFEKVATWNSESGTVNPPRREYKADAKGKE
GRYVRLEVTANNNNPLKIFEVEVNKGQKAPGTISPDFALTSDKKADKKALTDKNLATVFQ
ISQTDDKSYLEYRITDNVNLDSFTVLQAGSCEAKVTLKTADEKTKDLGKLTKTTQEFKGW
EENVHAVRFEFPKGKDVKLNEIILKYGENPSGDVGQAVENIPVDPGVEDSKETVNLALKQ
PVEVSGIETNNVKPESAVDGDENTKWDSAALKGSGAKSPQWIIVDLGTYTNMISEIKMSY
YNKVYPTDYDVQVSNDKENWVTVKTITKENNGSTNPVDTVKEELAQPVAARYVRILFRSI
NANAAGNCIGLKELTVNGVRRHVPVSYTSVAELENVNAEVNAENVALPALVETTVKAGEE
KEQPLKVIPTWDTEKIDTSKPADITVTGTLPINYSLVNPEALEAQVHVIVGEGGTEPENP
ERTNLALNQKVEVSDVETDFDGSKTDYVGEYAVDGKADTRWSSGPLNSKLGLGGEPKDQY
IVVDLGAGKNTIDEIKVSYFKKVWPTNYTVEVSADKNTWETVKTIKRNSSNDLNVVDDFK
LEEAKNARYVRLSFPKDGLNTNAAGSSVSITELEVYGTKEDITIDTGVLEEKIASAKELI
KNAEAEPNKYDSATVEVLKEALEVAENTLKNPESQEQVNKAAEELATAEAGLKELDLDAL
NVALKEAEEILAAESDYTPETYKVFKAAYEEAKALLGKPMTQQQAEEAKAKLETAQEQLE
KVEIVENEGWKETENGWEYYENGQKVIGWLYTGNHWYYMDDNGIMVTGWAAVDGHWYYMD
QWGAMCTGWVSVDGHWYYMDQWGAMQTGWVLVGDTWYYMNNSGAMQTGWVLVGDTWYYMN
NSGAMQTGWVLVGDTWYYMNNSGAMQTGWVLVGDTWYYMNNSGAMQTGWVLVGDTWYYMN
NSGAMQTGWVLVGDTWYYMNNSGAMCTGWLFVGDTWYYLNDSGAMCTGWVSVGGHWYYMD
QWGAMCTGWALVGDDWYYLNADGTMASNQWIGGYYVDASGKMV

Enzyme Prediction     

No EC number prediction in MGYG000000990_01429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	199	496	5.3e-75	0.9898305084745763
CBM32	1090	1204	1.2e-22	0.7983870967741935
CBM32	1343	1473	1.7e-21	0.8790322580645161

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.13e-100	199	496	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
NF033930	pneumo_PspA	6.31e-79	1667	1903	443	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.96e-75	1440	1845	231	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	6.42e-75	1704	1900	440	640	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.29e-63	1706	1903	485	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68920.1	0.0	1	1662	6	1667
AIY84741.1	1.44e-129	49	1043	40	1165
QCJ44358.1	8.74e-110	54	1042	38	1033
ASK62202.1	1.46e-108	39	1015	28	1124
APC49528.1	2.65e-107	85	1051	6	1099

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	5.87e-85	49	655	29	617	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	1.17e-73	46	670	25	652	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
2VVN_A	1.01e-58	48	791	18	737	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
6PV5_A	1.08e-58	56	572	42	554	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
5MI4_A	1.16e-58	56	791	16	727	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	4.53e-73	46	849	32	866	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	5.51e-58	48	791	18	737	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.19e-47	47	822	32	809	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	6.37e-47	47	568	32	548	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q2CEE3	1.47e-14	200	463	4	272	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000796	0.998123	0.000462	0.000221	0.000193	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000990_01429.