CAZyme Information: MGYG000000990_01790

Basic Information

• Species: Blautia sp900539145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900539145
• CAZyme ID: MGYG000000990_01790
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1780		198988.49	4.5253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000990	2534213	MAG	Denmark	Europe

• Gene Location: Start: 3922; End: 9264 Strand: -

Full Sequence      

MKSKKLKKAFAGLCTVALTVSSVPVSAQTEQTKAPQKESSLRLWYDEPASKGKNILNGGS
FGTTEEDNTWQQHTLPIGNSFMGANVYGEIGQERLTFNQKTLWNGGPSENRPYYDGGNKE
KADNGQKMSEVYKEIIELYKEGNDAQANELAKKLTGEVDGYGAYQSWGDIYVDFGLKEEQ
AENYVRDLNLENAVASVDFDYQDTKMHREYFISYPDNVLAMKFTAEGSEKLDFDISFPID
NAEGVADKKLGKAVETTVEDDTITVSGEMQDNQLQLNGKLKVETEGGKVQEKDGDKLHVS
GASEAVVYVSADTDYLNKYPDYRTGETAQELDASVEKAVDKASKKGYEKVKKEHIKDYSE
IFSRVQLDLGQNVPDKTTDILLKDYNAGKNTEAENRALEVLLFQYGRYLTIASSRAGDLP
SNLQGVWQNRVGDHNRIPWASDYHMNVNLQMNYWPTYSTNMAECATPLIDYINSLVEPGK
VTAKTYFGVENGGFTAHTQNTPFGWTCPGWDFSWGWSPAALPWILQNCWEYYEYTGDVKY
MEEHIYPMLKEAALLYDQILIEDEKTGRLVSAPAYSPEHGPVTAGNTYEQSLIWQLYEDA
ATAAEILGKDEEKAKEWRQRQQKLKPIEIGESGQIKEWYTETTLGSMGEKGHRHMSHLLG
LFPGDLISVDNAEYMDAAIVSLKERGEKSTGWGMGQRINAWARTGDGNQAHKLIQNLFHD
GIYPNLWDTHTPFQIDGNFGMTSGVSEMLMQSNMGYINMLPSLPDVWANGSVKGLVARGN
FEVSMKWADKNLTEASVLSRNGGTATVQTKNASLATVFDEKGNPVEMKALTADRISFETE
KGKTYIIKNIPQSVKVPTGLTAERLDEQSVELTWDEAEADGVCFNVYRKVGNGDVQLIAS
NVKTNSYKDVTAYEKLGTMKYQITAVTSELESEKTEFVTIKDKGVTAGMIDDTDSHIIYE
GAWGDWKEDVNYNGTIKYLNTPQGNESVSLNFVGTGIEVITCTNHDRGIMEVLIDDKSYG
KIDTYSAQTKRQQKVFEKDDLSYGKHTITLKVLNKSSQGAGKSTKVELDAFRVLDNTMSM
PASVQVSAVSGITTIGKANSTVQMKAEILPEDVQDKSVTWSSSDTSIAEVNENGLVTVKE
KNGEVKIIAVSKADTTKSGEVTLKVALKQENANTVTEIEDAVQENRKWKPNPSITWSEGW
STWDGEADRHHGGTKTEATGAGKFFEYTFTGTQIEIYVQKHQNCGNFEIYLDDEKVDTYS
FDTEIGTGEDQALLFKSEELSNREHRIKCVITDRDGKQQANLDYLKVYAPADSSALDKST
LQDVITEASVLSEEAYPQDKWAELQKIYKEAVSVMNKDDVKQEEIDKAAEALKAAIVALG
KAQPPVVKQETGKAILVESKQIVLEWDKVQGAKAYEITDNEHQVRAEATDTFVRVTGLEP
GTTYNFKIYAVNEGGKSEKAIEINEVTTTNPNEGNTIPPVTEIVKTVTGKDSVKLTWKAP
TDTKTAGYIVYVDGVKKGVAEKEAFTLQGLVKNQIYVVKIIAFDEEGHKSVPAQFAFSFE
EEEKEGWVQTGNGWEYYENGNKAIGWKDISGTWYYFNDNGIMETGWAEVNGHWYFLNDSG
AMETGWVFVNGHWYYMDQWGAMCTGWVSVNGHWYYMNDSGAMETGWAEVNGHWYYMNDSG
AMETGWVEVNGHWYYMNDSGVMETGWVEVNGHWYFMNDSGVMETGWVSVNGHWYYMDQWG
AMQTGWVFVGGYWYYLNADGAMVSNQWIDGYYVGASGQMI

Enzyme Prediction     

No EC number prediction in MGYG000000990_01790.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	67	813	6e-254	0.9722991689750693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.02e-81	1564	1778	442	658	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.65e-74	1604	1779	443	621	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.23e-73	1585	1778	487	681	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	4.09e-70	1603	1777	485	663	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
pfam14498	Glyco_hyd_65N_2	5.25e-58	43	317	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM69030.1	0.0	1	1597	1	1596
QHB24557.1	0.0	2	1565	5	1570
QEI32060.1	0.0	2	1565	5	1570
QRT30709.1	0.0	2	1565	5	1570
QNM13266.1	0.0	4	1379	9	1358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EAB_A	1.38e-229	43	847	20	894	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.05e-228	43	847	20	894	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]
2EAE_A	1.99e-228	43	847	19	893	ChainA, Alpha-fucosidase [Bifidobacterium bifidum]
2RDY_A	5.33e-135	40	847	2	789	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	2.92e-128	41	850	22	807	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.32e-101	75	799	67	804	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.49e-83	43	795	23	764	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	5.76e-70	60	811	29	800	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	1.48e-64	67	811	27	716	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2
P0DTR5	4.53e-09	942	1290	707	1061	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.998925	0.000254	0.000171	0.000160	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000990_01790.