CAZyme Information: MGYG000000991_00582

Basic Information

• Species: UMGS680 sp900544525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680; UMGS680 sp900544525
• CAZyme ID: MGYG000000991_00582
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		36853.57	9.5345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000991	3278188	MAG	Denmark	Europe

• Gene Location: Start: 4245; End: 5195 Strand: +

Full Sequence      

MEKKKEQGKGYQVDLVIPVYKPTKEFQKTLKRIEAQTRKPDRIILINTEKKYFDASCLEG
ISNVEVHHIKKEEFDHGGTRNQAAKLSSADIIIFMTQDAIPANQHMIEALLQPFEDEQVS
VVYGRQMADKKKSPIEAYTRTFNYPTISKKKTKEDLDTLGIKTFFCSNVCAAYRKKDYDQ
AGGFVTETIFNEDMILASKFIEMGKAVYYCSDAKVWHWHDYSAMEQFHRNFDLAVSQQTY
GGLFLKVKSESEGIRLVISTLKHLLHTGKWYLIPKLIWQSGWKFLGYRFGKSYEKLPKWL
IKKCTMNPSYWEKIFQ

Enzyme Prediction     

No EC number prediction in MGYG000000991_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	15	179	4.8e-20	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.54e-13	14	176	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	2.17e-11	2	216	45	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd00761	Glyco_tranf_GTA_type	1.44e-10	16	126	2	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1216	GT2	1.04e-08	16	303	8	293	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06434	GT2_HAS	3.64e-08	13	215	2	212	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQP38206.1	2.05e-140	13	312	3	303
CBL37393.1	2.05e-140	13	312	3	303
QUF79163.1	6.74e-130	13	312	7	306
SOB72012.1	1.36e-129	8	312	2	306
QCP35188.1	8.08e-129	13	312	3	302

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	1.03e-61	13	314	3	305	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000991_00582.