CAZyme Information: MGYG000000991_02582

Basic Information

• Species: UMGS680 sp900544525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680; UMGS680 sp900544525
• CAZyme ID: MGYG000000991_02582
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		89267.19	4.9389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000991	3278188	MAG	Denmark	Europe

• Gene Location: Start: 189; End: 2528 Strand: +

Full Sequence      

MKFGNGCWLQKEGIECFPPQEVYFVDKKENEVVICAPTHHIAHRGDTLGGINLTIRITAP
AKEVIRVQVSHHLGVNKKSPEFELNLNEYGHLDVRETEEELYIKNGSLSLRIQKKNWSME
YERDGKLLTKSEGRDLAYMRTQWTGFAYDMDPTGKAYMRQQLGLSVNEHVYGLGERFGAF
VKNGQSIDIWNEDGGTSTDQSYKNIPFYVTDRGYGVFVNHPEKVSFEVATEQVAKVEFSV
AGETLDYFFINGPSMKEVLMRYTDLTGKPALPAPWTYGLWLSTSFTTNYDEETVMSFIDG
MQERGIGLRVFHFDCFWMKEFHWSDFLWDNRVFPDPEGMLRRIKEKGLNICVWINPYIGQ
ESVLFKEGMEKGYFLKRNDGSVWQWDMWQPGMALVDFTNKEACKWFQEKLEVLLDMGVDC
FKTDFGERIPVNCVYADGSDPEKMHNYYTYLYNQTVFELLERKRGKGEAVLFARSATVGG
QKFPVHWGGDCWSDYVSMEESLRGGLSLTMSGFGYWSHDIGGFESTSTPDVYKRWAAFGL
MSSHSRLHGSTSYRVPWAYDEEAVDVVRYFTEVKAGLMPYLYRNCIETAKTGVPMMRSMV
MEFTDDRTCAYLDKQYMFGDSLLVAPIFNEESKAIYYLPEGTWTHYLTGEVKEGGKWYEE
DCGYLSIPVFVRENCLIAVGKETSRPDYDYADQVTIKAYALQEGKEAKTVVYNMNQIEDT
VVAVKKENGKVKIHVEAEKPCRIVLVNQLVTAVENAESKVEGNDTVITCDGTKEITCIC

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	247	676	1e-127	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10658	PRK10658	0.0	1	674	1	665	putative alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	0.0	267	577	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	0.0	8	767	1	754	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	3.62e-176	248	677	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	6.22e-81	167	674	81	620	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU68449.1	0.0	1	777	1	778
BBF45281.1	0.0	1	775	1	777
ABX40605.1	0.0	1	767	1	767
VCV21669.1	0.0	1	767	1	766
CBL11696.1	0.0	1	767	13	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	6.63e-298	1	707	1	699	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	7.91e-298	1	707	1	699	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.58e-283	2	707	2	699	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	2.71e-107	172	682	206	720	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	2.36e-77	94	737	180	869	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	3.51e-297	1	707	1	699	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	1.05e-236	1	696	1	715	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	2.32e-236	1	734	1	730	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	2.08e-80	94	713	86	708	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	1.60e-62	158	704	102	649	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000991_02582.