CAZyme Information: MGYG000000991_02841

Basic Information

• Species: UMGS680 sp900544525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680; UMGS680 sp900544525
• CAZyme ID: MGYG000000991_02841
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		64040.42	4.9278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000991	3278188	MAG	Denmark	Europe

• Gene Location: Start: 1201; End: 2922 Strand: -

Full Sequence      

MGRLVDLTAKPYNLSEEQIQWVESTLASMTAEEKVGQLFTNLFFFGKDEFSGNDLTNKQI
LEKYHIGGARFHGGEAKQVQELLNQLQTDSKIPLLVAANCDSGGNGACSNGTYIASGAQC
EASKDPSVAFNAGLVSAREASALGVNVNFDPCVDILYNWRNTIVNTRAYGTNADDVIKYT
SAFIEGYRSERDMITCIKHFPGDGTEERDQHLVLGVNELSPEEWDNSFGRVYSTHIENGV
EMIMAGHIALPEYQKKLNPSLEDKDILPATLAEELIQGLLKEQLGFNGMVITDASHMLGM
TSAMRREDYVPAAIAAGCDMFLFFNDLDEDFNFMLNGYKKGVITEERMNDAVRRVLGLKA
KLNLHKKKEEGTLLKDEKELEIIGCEEHLKMRADAADKGITLVKNTLNQLPIRPETHKKI
RLYYLEGETNGIMASSSALEGFKAELESRGFEVSINDGSTRIKGRTDKYREEVDAAIVIA
NVVGYGAENNYRVKWKTAMSSDCPWYVWEVPTFAVSLNYTTHLHDLTMVKGYINAYHNNP
ETIKQVVDKLMGESEFKGSYNDLVWANKWQAKL

Enzyme Prediction     

No EC number prediction in MGYG000000991_02841.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	322	3.7e-47	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.72e-63	29	431	1	369	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.27e-53	30	358	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.76e-22	129	326	99	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.52e-17	4	413	19	408	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK52013.1	0.0	1	573	1	573
AEB30772.1	0.0	1	573	1	573
ANK39063.1	8.82e-318	5	573	4	574
ALM57935.1	4.41e-317	5	573	4	574
QDW85560.1	7.94e-317	5	573	4	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	1.58e-119	7	573	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	3.60e-43	29	420	42	455	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.29e-42	29	420	16	429	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.80e-42	29	420	46	459	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	4.17e-33	28	559	10	526	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	1.07e-120	4	573	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.97e-42	29	420	42	455	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q2UFP8	1.02e-19	22	471	57	535	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
Q5QUZ5	1.38e-19	49	326	7	279	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
P48823	1.63e-19	59	413	57	426	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000991_02841.