CAZyme Information: MGYG000000993_00083

Basic Information

• Species: Haemophilus_D sp900756155
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D sp900756155
• CAZyme ID: MGYG000000993_00083
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729		83749.32	5.146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000993	1983283	MAG	Denmark	Europe

• Gene Location: Start: 83041; End: 85230 Strand: -

Full Sequence      

MTKLVAQSVINSFFDGKHADPFAVLGMHETHNGIEIRALLPDADKVEVIDKESQSIVVEL
EKLDDRGFFAAIVPEIHHFFAYQLKVYWGVEAQIIEDPYRFHPMINDLEQWLLAEGSLLR
PYEVLGAHFTECDSVPGVNFRVWAPNAKRVSLVGDFNYWDGRRHPMRFHPASGVWELFLP
KASLGQRYKFELIDCNGNLRLKADPYAFRSELRPDTASEISMLPDVVEMTEQRRKANQRN
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVKHMGFTHIEFLPLSEFPFDGSWGY
QPIGLYSPTSRFGTPEGFKRLVEKAHKAGINVILDWVPGHFPSDTHGLVAFDGTALYEHA
DPREGYHQDWNTLIYNYGRNEVRNFLSSNALFWLERFGVDGIRVDAVASMIYRDYSRAEG
EWIPNQYGGRENLEAIEFLKHTNWKIHSEVSGAISIAEESTSFGGVTHPTENGGLGFNFK
WNMGWMNDTLSYMKLDPVYRRYHHDKMTFGMIYQYSENFVLPLSHDEVVHGKCSLLGKMP
GDAWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYEESLDWFLLDENHGGLWHKG
VLQLVKDLNGIYQKNAPLFELDGEPEGFDWLVVDDAENSVFAFERKSSDGERIIVISNFT
PVPREGYRIGVNVAGEYEEILNTDSMYYQGSNVGNFGLVESEAIASHGRENSISVTIPPL
ATIYLKYKA

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	274	574	4.9e-160	0.9966777408637874
CBM48	125	209	1.6e-22	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	102	728	4	628	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	100	727	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	16	726	514	1221	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	113	729	15	623	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	5	729	1	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR20734.1	0.0	1	729	1	729
QOR18928.1	0.0	1	729	1	729
QOR11382.1	0.0	1	729	1	729
QOR15011.1	0.0	1	729	1	729
QOR16991.1	0.0	1	729	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	0.0	119	729	3	611	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	0.0	112	729	1	616	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
5GQW_A	2.98e-250	1	726	21	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	4.22e-250	1	726	21	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	5.98e-250	1	726	21	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1CDL3	0.0	1	725	1	723	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=glgB PE=3 SV=1
Q4QK67	0.0	1	729	1	729	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=glgB PE=3 SV=1
Q3YW93	0.0	1	729	1	727	1,4-alpha-glucan branching enzyme GlgB OS=Shigella sonnei (strain Ss046) OX=300269 GN=glgB PE=3 SV=1
Q1R5J4	0.0	1	729	1	727	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=glgB PE=3 SV=1
Q65TI0	0.0	1	728	1	728	1,4-alpha-glucan branching enzyme GlgB OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000993_00083.