CAZyme Information: MGYG000000994_00339

Basic Information

• Species: Dialister sp900541485
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900541485
• CAZyme ID: MGYG000000994_00339
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		21470.58	4.7014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000994	1548184	MAG	Denmark	Europe

• Gene Location: Start: 82512; End: 83087 Strand: -

Full Sequence      

MSRKVEVSRLDTSWGKKIFTFLLGVGSLFCFFILSSPSIWKPSPAVQQIINESAAREQLS
PFLIEAVMLTESKFDERAVSKVGAVGMMQLMPETAAWISEVSGLPADHLDRPGENIPLGA
WYLNFLLKKYHNNEVLALAAYNAGRGNVDEWIEELGWKEDYSAIEGIPFPETREFVKSVV
TARDRLEEESK

Enzyme Prediction     

No EC number prediction in MGYG000000994_00339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	185	3e-28	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.41e-68	47	185	5	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.97e-52	49	181	9	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.58e-42	61	182	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.16e-35	50	161	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	8.65e-31	45	179	138	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	8.13e-80	3	191	8	196
AOH39655.1	2.35e-58	8	189	6	189
CCC73618.1	9.80e-44	49	180	13	147
AVO73570.1	2.56e-43	49	180	45	179
AVO26251.1	2.56e-43	49	180	45	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.34e-18	49	181	453	587	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.39e-18	49	181	482	616	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
5MPQ_A	4.47e-18	43	180	414	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.48e-18	43	180	418	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.49e-18	43	180	424	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.14e-17	45	181	59	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	5.42e-16	45	180	479	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.51e-15	66	180	500	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.51e-15	66	180	500	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	6.16e-15	45	180	427	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000020	0.000001	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
21	40