CAZyme Information: MGYG000000994_00742

Basic Information

• Species: Dialister sp900541485
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900541485
• CAZyme ID: MGYG000000994_00742
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		39617.64	8.3111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000994	1548184	MAG	Denmark	Europe

• Gene Location: Start: 80177; End: 81208 Strand: +

Full Sequence      

MIQEENSTLFDTIITGEKVICPALEKNRELPVYDFAFGSSPDYVCRIGVTIASILENNPD
LHLRFNIFIREISKNDLEKLTILSDTGGCQIILYFVDDMPFTPMLHEDKQASIFYRFLFA
PILAKKGSSRIFSIDGDVLCNGSISSLLSVDFNGKIAAAVRDTSEEYADYRRSLVGTKQY
FNSGMIMIDTAAWNDNKISEKCWDLAIERRKSGKHLHSHDQDILNILLNNDILLLPPKYN
YIYNLDMKSFFQKQSPIHFDKSAVFIHYAGVVKPWRTWIQDLYGVKLYRNAWLASPWKDV
PLTGFTRHKDIHQAARHARRMHNYKEMLSLYMKYLFTKLGVSK

Enzyme Prediction     

No EC number prediction in MGYG000000994_00742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	36	278	5.5e-43	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.12e-45	36	277	4	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	3.24e-43	36	339	6	317	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK15171	PRK15171	5.04e-36	26	339	19	333	lipopolysaccharide 3-alpha-galactosyltransferase.
pfam01501	Glyco_transf_8	1.81e-31	36	278	3	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
pfam08437	Glyco_transf_8C	4.88e-09	285	335	3	53	Glycosyl transferase family 8 C-terminal. This domain is found at the C-terminus of the pfam01501 domain in bacterial glucosyltransferase and galactosyltransferase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25902.1	2.93e-117	32	338	30	336
BBK25792.1	1.97e-62	29	339	20	327
VEI39581.1	2.26e-41	34	343	25	327
AZK60967.1	1.09e-40	24	339	19	336
AMH12465.1	1.70e-40	34	343	25	327

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19817	1.34e-35	27	339	20	333	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	3.80e-35	36	299	31	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P27128	1.05e-34	34	339	30	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19816	1.43e-33	17	339	8	335	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
A0A0H2URH2	9.56e-17	43	292	13	241	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000037	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000994_00742.