CAZyme Information: MGYG000000997_01575

Basic Information

• Species: Roseburia sp900548205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900548205
• CAZyme ID: MGYG000000997_01575
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	MGYG000000997_49|CGC1	81232.5	4.8096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000997	2319952	MAG	China	Asia

• Gene Location: Start: 4791; End: 7019 Strand: -

Full Sequence      

MEKELAKKRAKELCSRLTLKEKIGQLCQRLYGFRVYEKDSDGSFTYTEEFVKEVEACGGL
GTLYGLFRADPWSGRGYETGLCDEEAVRVYNMLQKYVLEHMRIPIPMLLGSECPHGHQAL
DGYLLPVNLAVGATFAPNLAKEAAEVCGRQLFGMGINLALVSMLDILRDPRWGRSEECFG
EDPYLAGCMAEAVVSGIQKQGVGVVAKHFCAQGETTGGVNASAARIGERELREIHLPAAR
ACCKAGVSGVMAAYNEIDGIYCHANEALLNGILRGEFGFDGVVMADGAAIDQLDVMTGDN
VRSAALALRAGVDVGLWDEAFFKLDEALGRGLVRMEDIDRAVLRVLTLKYEQDLFEKPYI
GADGRRVAEYPTDGAAQTFSYGEYPQSMRLAEESVVLLKNENGALPRRQAEEKIAVIGPA
ADDLYRQLGDYSPPLRQGCGRTIWQGLNEQAAGRELRLSTGDDLEEARALTAWSDVVILA
LGGSSSRFSGAEFAKNGAALKSGGMQMDCGEGVDCASLRLPGDQGKLFTAVAGAAKTLVT
VTVAGRPYAIPEIKEKTDALLYAFYPGPMGGAAIAKLIYGERSPSGRLPVSLPRSVGQLP
VYYDHRRSYGAMRYCDEEDGALYTFGEGFGYSSFSCDDVRLDAAKEQLTLHCVIKNTGMW
EDAVVLQCYRRLKSCEIVPRERELVAFAKLWLAPGETRETELVIERERLYIYGNDRTWKA
AEGEQELLLMDGGNELWRGNFI

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	315	5.7e-62	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.66e-113	12	722	40	742	beta-glucosidase BglX.
COG1472	BglX	6.08e-74	94	432	49	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.79e-58	18	348	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.64e-46	164	740	158	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.85e-46	395	631	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV20391.1	9.00e-304	6	733	5	725
CBL14322.1	9.00e-304	6	733	5	725
QHQ61803.1	5.90e-268	6	742	12	782
BCJ98686.1	8.24e-263	9	742	15	782
ASM70685.1	4.45e-261	1	733	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	9.01e-86	8	707	45	748	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.06e-84	75	729	54	737	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.50e-84	75	729	54	737	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	6.18e-83	98	724	65	713	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	3.20e-82	98	724	65	713	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	6.40e-85	12	741	40	762	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.39e-84	12	741	40	762	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.38e-77	9	729	39	740	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	9.90e-76	102	715	62	692	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q23892	1.78e-55	13	736	83	816	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000997_01575.