CAZyme Information: MGYG000001000_00511

Basic Information

• Species: UBA4716 sp900556575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716; UBA4716 sp900556575
• CAZyme ID: MGYG000001000_00511
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478		54072.37	4.3643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001000	2124642	MAG	China	Asia

• Gene Location: Start: 7329; End: 8765 Strand: -

Full Sequence      

MKAGKILVLAAAAAMCLGVNSYAEEFYRGGDITELSYIESLGGKYYDADGNNCDALDILS
ENGMNMARIRLTNTPGKGNGDGVYYLPAGFQDENDCLSLAKRAKEHGMKIQFTFNYSDYW
SNGSRQIIPSEWVKQIKDELGYDVRNADFLNKMTAEQRAEIIDKLEKIVHDYTYDIMNKL
KEQGTVPEYVSLGNEIRGGLLFPFANTYKANMNRERFELVFGEDKSDNDIICPEDWESLA
RFINAGYEAVKEVSADTRVIIHLDDGSKVDKFTWYLDKLENAGAKYDVIGASYYPAWSEN
TIETCVDFCNEITKKYDKDIMIMESGYNWNDTISDGSAGQLVDIDAYKDVFPPTQEGHYG
YMTALFEGLRLVEDNRCLGVLYWDPLMIHVDDGNGGSLSGWAYRESDDGVEKNIVENTTL
FDFNGKAIKSINAYREDKEKNTVGLIKPQYDENGRLTDVKIKEADIRDAENNLYVRSK

Enzyme Prediction     

No EC number prediction in MGYG000001000_00511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	162	433	3.9e-58	0.6812865497076024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	2.55e-80	1	434	14	391	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	6.04e-80	27	434	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGI39701.1	4.97e-116	25	446	490	865
AGC68692.1	4.97e-116	25	446	490	865
ANW99026.1	6.16e-115	25	446	490	865
ANX01554.1	6.16e-115	25	446	490	865
QNU65257.1	6.03e-113	20	435	281	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	5.94e-50	25	435	49	392	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	9.73e-40	19	435	17	389	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	6.83e-39	19	435	17	389	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	1.43e-33	27	435	4	330	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
6GPA_A	1.23e-31	24	326	5	257	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	4.70e-49	24	442	4	354	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	8.54e-39	19	435	42	414	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
P48841	6.29e-38	26	421	27	364	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
O07013	2.24e-36	19	435	46	418	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P83692	7.84e-33	27	435	4	330	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000553	0.980526	0.018111	0.000249	0.000276	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001000_00511.