CAZyme Information: MGYG000001001_00642

Basic Information

• Species: Prevotella sp900540375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540375
• CAZyme ID: MGYG000001001_00642
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		93701.57	6.7722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001001	3195691	MAG	China	Asia

• Gene Location: Start: 57828; End: 60299 Strand: -

Full Sequence      

MNKIFLFLLLLFPLLAKAADFDIVKPGQQPATIVVDTTDWTGVRLAARDLSADIGRVCGK
AAPVLVATAAHQPGQGCIIAGTMGKSKLIDNIVKAHKTDVRKLRGQWESYLIDVVDGNLV
VIGSDKRGTIYGIYEISREMGVSPWYWWADVAVKHQDHIIYSSGRQYQPSPRVKYRGIFL
NDEAPCLTTWVKNTYGTNYGDHRFYDRVFELLLRLKANFMWPAMWSWAFYTDDPLNSKTA
DDRGIIIGTSHHEPMCRSQKEWHGHTDNPNVEPQDRTSREAAGGQWNYATNQKALDDFWA
GGVRRNKGTEDIITIGMRGDGDMAMSEDTNIQLMEKIISNQRRIIEKERGKKAGEVPQVW
ALYKEVMDYYDAGLRVPDDVTLLLCDDNWGDVRRVPTPKERNRKGGWGLYYHVDYVGAPR
NSKWINVTPIQNMWEQLTLAAENGIDRLWILNVGDLKPMEYPIQLFIDMAWNPTACTTEN
LLDHTRRFCAAAFGEDQATETTRILNLQCKYAGRCTAEMLDAKTYSLKDCEWQKVVSDYA
ALERDALRQYTSLPENCRDAYQELILFPVQAMANLYDMYYAQAMNHQLYEQGNPDANTWA
ERCRNDFRRDSLLCAAYNHDIAGGKWNGMMIQKHIGYTIWNDNFPHDMLPKLYTVKPRTD
GWVIDAEGGKVVLEAEHYFSKRDGEGAHWIDIPFMGPSLGAMTLRPTTASVRGAQLEYRF
RGMQPADSVTVTVATKCTLDFLNQGGLRYRVNLDGRSQTANFNANLNEKPENIYSIYYPT
VARRVVEKQITLPLQQLADGIHKLVFEPLDPGVVLEKITIKTK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	27	818	3.1e-268	0.9870875179340028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	170	519	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.99e-25	668	820	6	158	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.002	46	135	36	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34758.1	0.0	32	820	10	783
BCS85271.1	0.0	22	820	32	813
QNL40611.1	0.0	16	820	28	823
AGB29053.1	0.0	17	820	36	816
QUT26893.1	0.0	21	820	33	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	21	820	44	834	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	8.03e-313	21	820	17	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	5.86e-310	21	820	16	818	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.64e-184	31	683	23	657	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	5.00e-104	78	668	65	679	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999046	0.000208	0.000164	0.000173	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001001_00642.