CAZyme Information: MGYG000001001_01063

Basic Information

• Species: Prevotella sp900540375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540375
• CAZyme ID: MGYG000001001_01063
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	MGYG000001001_11|CGC2	71959.83	7.4963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001001	3195691	MAG	China	Asia

• Gene Location: Start: 54754; End: 56679 Strand: -

Full Sequence      

MLLIVMLVVGLCLLVCTVRGAVPEKNTVSPAVASLLTPWEPANTLIDLTATLRGRRHQVA
LFSDAGSWMAFGLQAAAKTPRGPYSIYQRRWLAEALVAPGGAVVGKTCYTPGVITLATNR
LRQRLFFVDAHTTLLTLEGSLPAGWSCAAKGLPSDAAVSTAGNTVTIGYTGGERLLLTFP
KGIIVTANGHNYIATLDSVATRLDVAISFLWDKMVEERTQTLAAAWMLDHTNTLWKENRD
RWTGYLSKVIRNDMKPTYNRVAAKAAVTLIGNWRQQRGGLLHDGLIPSFSVDYFVGCWAW
DCWRLSAALASFAPKLAMDNMRVMFDWQQSDGMVPDCVYPNPQENNYRNSKPPLAAWAVD
KIWESTHDTAFVREMLPKLTAYHRWWYRYRDHNHNGICEFGATDGTLEAAAWESGMDNAI
RFDSARMVRNGDNAWSLDQESVDLNAYLALDRRLIEKLENVAGGKRATGYPFDKSAVELA
DGVNKAFYDADTHWFYDRRLNSHAFVREMGCEGYVPLWVGIATRAQFSGIFHWLKDTKKF
STYIPFPTIAADNAKYDPNGYWRGPIWLDETYYAIEALRHYLPKPDEADRYTRQVFDRLQ
GLTGHGAIYENYDTKTGAPLQSANFSWSAAHLLMLYNDYGL

Enzyme Prediction     

No EC number prediction in MGYG000001001_01063.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	200	639	2.1e-97	0.5368421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	6.34e-112	241	639	288	783	alpha-glucosidase; Provisional
COG3408	GDB1	1.01e-18	296	636	283	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.00e-11	350	640	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	3.71e-08	553	635	401	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	4.88e-05	340	522	192	420	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67704.1	9.09e-219	45	640	32	625
ADY37311.1	8.62e-207	45	640	39	637
AVM58118.1	8.24e-206	43	640	36	641
ADV42528.1	1.04e-204	43	640	36	641
QUT89313.1	1.68e-202	43	640	36	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	7.78e-78	238	639	258	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.03e-77	238	639	258	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	5.60e-77	238	639	258	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.01e-74	238	639	259	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.85e-37	238	403	584	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	6.43e-77	238	639	281	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.03e-21	298	633	98	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.37e-21	298	633	98	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	2.54e-09	252	633	3	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
Q19426	4.23e-07	342	638	453	793	Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans OX=6239 GN=mogs-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999246	0.000147	0.000142	0.000129	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001001_01063.