CAZyme Information: MGYG000001004_00148

Basic Information

• Species: CAG-56 sp900539525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900539525
• CAZyme ID: MGYG000001004_00148
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	MGYG000001004_3|CGC1	101338.84	6.3331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001004	2903340	MAG	Austria	Europe

• Gene Location: Start: 2835; End: 5501 Strand: -

Full Sequence      

MNRNGDAIDIVIPVYNGYDDIQLCMESIRKYTDLERNRVILINDCSPDERIRPFLDAQAE
ANIVVLHNEKNQGFSANVNKGMTYSDRDVILLNADTIVTKNWVEKIQACAYRSVRTATVT
PLSNSATLCSVPVMCQDNPVPENVTVDEYAALIERCSLHRYPRITVAVGFCMYIKQHVIE
EVGLFDAETFGRGYGEENDFCNRCEQLGYRHVMCDDTFIFHKGTASFDTAEKQALCDAHN
TILEDRYPVQMKKNHLYCMENPDQEIRDNIEMYTKLFNGHKNILYLLHLDFQTEAFNNIG
GTQLHVRDLMLHLRNEYNIFVAARDVDCLRVTAYTAKDEISLKFYIGEAEDFPVFYDEEL
AGIYEQVLRAFSIDLIHVHHTQDLSLDIYTVADRLGIPVVATLHDYYYACPTVKLLNAEG
RFCPDQKKRACVSCLNRTCGFAGQVSYIEKWRRENERALSLSERLIFPSESARQVVMDVF
PSLERKAMVIPHGSDLVKNEKHSIALKGEIEKTKDVKTHLDQVPGTKRGFNYVTGWAYYA
KADNREVKLYLEVTDAADQVFHVPLQKKARPDVVNSTGLPCVLWCGIHTVFSIPDMAEGK
CKLRIILEVQGHYYTDGKCYSGNYRAEQGEPGRLNVAFIGGMVPAKGSRLVYELLQMETD
RINWFVMGAIGDDCLNRLEGRPHTYFSNVYEKDDIFELLKSSKIDVICIMPTWAETFCYT
VSEAWLCGIPVIGADIGAVGERIRRTGAGWVVDVDTKPEELLTLLHHISQHPQELKEKRK
ITERLSLRTVEEMCGEYREFYRNLTEKHPVSHTDAGIDFDFIFQGLALGNPHVRGKGRVA
SLNMLREENKRLAASMEMLKGTTSYKVARKISDANIPFKETLKKIMKR

Enzyme Prediction     

No EC number prediction in MGYG000001004_00148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	112	1.6e-19	0.6176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	1.06e-24	282	803	1	357	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
COG1216	GT2	4.18e-24	4	228	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	5.08e-21	10	223	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd03801	GT4_PimA-like	5.23e-18	282	802	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00535	Glycos_transf_2	2.03e-17	9	112	1	105	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK78211.1	2.88e-163	8	801	4	761
QMW89727.1	3.62e-163	8	801	12	769
AVQ96149.1	1.53e-147	4	852	3	715
AYF41559.1	1.53e-147	4	852	3	715
QCN92390.1	1.53e-147	4	852	3	715

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001004_00148.