CAZyme Information: MGYG000001004_00220

Basic Information

• Species: CAG-56 sp900539525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900539525
• CAZyme ID: MGYG000001004_00220
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1837	MGYG000001004_4|CGC1	200338.93	4.6177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001004	2903340	MAG	Austria	Europe

• Gene Location: Start: 16106; End: 21619 Strand: -

Full Sequence      

MKRKKQFIGILLSVSLLASSILPAAAFEKPANAEEVLQDGYASTQDAYAIYPVPQHTAYT
AGSFELGTDVQVVAEPGIDQYTEDFLSEILEDYGRTEKESQTVAESQQILLGIDGSNGVV
DTWADSHVQLSDSELFTKTDSYVVSAKDGTIMILGKDTDAVYYGLATLQMMFSSFNGEKF
LNAQIEDYAVMKTRGFIEGFYGGWNYEGRESLMRFARDVKMNTYIYASKTDSYHKNDVLY
PAEDIAKIAELVEVGKETKVQYGWSVHISYFFNRLKDMTVGSDDYNAAFEQNFTKLVAKF
QQLYDAGVRKFAILNDDFGAGSHSEVVRFLNKLDNEFLVPKKCENLTYCMQGYNRAWSGN
GAELEVLKGLNDSIDLFWTGDDVNSPITQDTVNFLREKTNHEPVFWLNYPVNEHGPSGVY
LGNITHYARDGVTGLAGAVSNPSRFTEANKVGLYQLGCLFWNNNNYLEKANTIWEEAFKY
LQPEVYDAYLTIARNVSNCPGSGRVPAGFPESEYLKDTLDKVTEAINSGATLEGDADVTA
LMTEFKHMTDAVTEFRGSCANTELVAELDPWLKSLNDVATAGRKVLEALIALEKGDVMGG
WDAFSIAGKAMDTQDTYPTYQGSNNKAKAGSKYLVPFVKRAVAVAKDMLAPYMGSGSAEP
NPVFYGMFGGNAVEAGAESTKAMDGNLSTYGSFQTDQKLNDYFGIDFGTPVLVKNVTFVQ
GKDDTHHDIFHFFSLEYSEDGNTWTNVEDYTEEGSIHKIEKALNVKARYVRVRLTQLGGT
YNGSHKNNFWTFVREVSADWEEIPAYEAIGSTTEQTGSVSVEDKTYALTLAGDVSLAPGE
YAGIKLEELAQLTSVVCQGSGTDALTLEYSENGAVWQTVPAQLNGELARYVRLVNRTEST
QSITLSKFEATVAEAQMRPSLSVSGFSGLQGSWRDLFDGDTSTTVQTTDAQSKDDYILVD
LGVTTAIHDLQITTTDDKPFQNAKIQVSVDQNTWEDIATVTNKGGDAVRDNIFYRITKNL
NGKEVRYLKLLITADAQEALQLCNIDINRTAEKVNHAITGNVTGDLEKIIDGSISTVFAA
EEVSDGTAYIEYKLTENTKIDSVIFLQDGAAITNARVTAQVYDGEKIETVSLGELDMASR
QFGLDVSKDVLSFKVTWPSGTTPVLYEIITTTPQEQNLKSICTVTESGSGLQKVEYAVDD
DTNTRWEGNAIKGGAATTTSWIQADMGEGRNVSVSRMTVSFYLKTYATDYDVQQSEDGQA
WETLATLTNENGDTRDLLNTITLEKPAVKRYIRLFFRSMNANAAGHAVGIREWDIYGTTD
REILEPAAATEEQIAQLQGMIQTLKSSIKEASAYPEDSYQAYAQALAAAEMILKGSQPKA
TPLQNALENLDTAAKPLKDLDAAKEKLQELINGLDIKDASAYTEDSYQAYVAALAAANAA
LTQGNLKAADIEKAKADLEAAVRGLKEKDESKNSLQDFIDGLEGSIKDASAYPAELYQAY
VAALEAAQEVLSKADPEAADIEKAKTDLEAAVKALKDLDAAADAQKEALRELISGLAGSI
KDASAYTEDSYQAYVTALAAANAALTQGNLKASDIEKVKMDLDAAVRALKPADPTNQDPG
NQDPGNQDPGNQDPGNQDPGNQDPGNQKPSDKDPSKPTPQPEQPGNNTPAPIPGKVYEKN
KVNYKVTSVSGQTVEAVNTTNNKLTSVKIPDQVNIEGKNYKVTSIAASAFKNHKKLRSVT
IGKNVTVIGANAFANCTSLKKVTVNSKSLKQIDGKAFSGCKKLTSVRIKSTSLKKVGKSA
FKGISKKAVIKVPAAKLKAYKKLLAKKGQSKTVKITK

Enzyme Prediction     

No EC number prediction in MGYG000001004_00220.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	194	492	3.4e-63	0.9898305084745763
CBM32	1188	1302	2e-18	0.8145161290322581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.34e-93	194	492	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
sd00036	LRR_3	3.12e-23	1702	1813	14	114	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	1.62e-21	1721	1813	1	91	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	3.42e-21	1702	1803	37	127	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
pfam13306	LRR_5	2.24e-20	1701	1803	10	100	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68920.1	5.22e-240	1	1317	6	1226
AIY84741.1	1.34e-165	43	1196	40	1195
APC49528.1	9.98e-161	73	1169	1	1089
APC49529.1	1.91e-159	43	1169	29	1146
ASK62202.1	5.36e-158	10	1193	7	1177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	1.38e-91	46	647	32	626	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	6.39e-79	44	639	28	638	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
5MI4_A	4.70e-52	125	639	75	573	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
6PV5_A	7.35e-52	49	601	41	587	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2J4G_A	1.29e-51	125	639	63	561	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	2.17e-109	16	1170	8	1350	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	9.44e-51	125	639	85	583	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	9.19e-42	52	872	48	819	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	9.19e-42	52	872	48	819	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
O60502	6.53e-14	195	469	63	341	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000787	0.997106	0.001240	0.000355	0.000268	0.000221

TMHMM  Annotations     

start	end
7	26