CAZyme Information: MGYG000001004_00631

Basic Information

• Species: CAG-56 sp900539525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900539525
• CAZyme ID: MGYG000001004_00631
• CAZy Family: GH13
• CAZyme Description: Glycogen operon protein GlgX

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	MGYG000001004_10|CGC1	71033.24	5.2711

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001004	2903340	MAG	Austria	Europe

• Gene Location: Start: 63989; End: 65842 Strand: +

Full Sequence      

MKKEIPEQMRCTACKDMGRLGVTKEKDGIVFRAAFDETEEIFLLLYKKGSDEIVNEISMS
EWRQIGNVYAVKMENLDDRKYEYNYRVGNKVIQDPYAGVIRGRNVFGEQVADEDGHQIRC
GFDFEAYDWKEDEPLQIPYEDAVMYSLHVRGFTMQANSKVRYKGTFRGVAEKAAYLRDLG
INQVKLMPAYEFDEIIKCYTGRYMSYEEEGKNTKLNFWGYGEGWYFAPKASYASGSDPVK
EMKDMISVLHQNGIEVLMEFYFTKDINVRMVTDCLTHWITDYHVDGFHLPGNDAMISMLA
KDPVFAGTKLLGSSFSTEEIYSNGKLPSRRNLAEYNAGFMQNARGLLKGDEDQLYHFVYR
CRKNPPASGVINYMASHDGFTMMDMVSYNDKHNGANGEQNHDGPVYNISWNCGMEGPSRK
KKITELRNRQLRNAFLMLLLANGTPMIQAGDEFGNSQDGNNNPYCQDNEISWVDWKAARR
NVELTAFVRDVIAFRMRHRILHMPRELKVMDTLSCGYPDLSYHGNRAWYGEFDNGNREIG
MMYCGQYASEEEFLYVAYNLHWEEQEFALPSLPEEMQWYVAIDSSTGVYPEGEEKACGTQ
KTFSVPGRTIIVLIGRR

Enzyme Prediction     

No EC number prediction in MGYG000001004_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	263	456	9.9e-53	0.6068376068376068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11326	AmyAc_Glg_debranch	4.16e-128	127	498	1	433	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	7.72e-114	20	617	20	693	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02100	glgX_debranch	1.94e-111	82	613	66	686	glycogen debranching enzyme GlgX. This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK03705	PRK03705	6.97e-73	83	500	70	561	glycogen debranching protein GlgX.
PRK14510	PRK14510	4.55e-63	20	576	16	653	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW79391.1	3.61e-194	18	617	20	645
QIB54880.1	3.61e-194	18	617	20	645
QBE97456.1	4.55e-194	18	617	6	631
CBL24215.1	8.21e-188	21	617	18	611
SEU00412.1	3.76e-187	20	617	16	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VNC_A	7.08e-67	24	523	26	616	Crystalstructure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	8.30e-67	68	585	132	781	CrystalStructure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
2WSK_A	9.93e-47	119	497	128	560	Crystalstructure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
1BF2_A	9.20e-28	140	616	177	750	StructureOf Pseudomonas Isoamylase [Pseudomonas amyloderamosa]
2E8Y_A	5.95e-25	141	515	214	633	Crystalstructure of pullulanase type I from Bacillus subtilis str. 168 [Bacillus subtilis],2E8Y_B Crystal structure of pullulanase type I from Bacillus subtilis str. 168 [Bacillus subtilis],2E8Z_A Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with alpha-cyclodextrin [Bacillus subtilis],2E8Z_B Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with alpha-cyclodextrin [Bacillus subtilis],2E9B_A Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with maltose [Bacillus subtilis],2E9B_B Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with maltose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O04196	9.70e-78	21	585	78	734	Isoamylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA1 PE=1 SV=1
Q9M0S5	2.58e-75	16	613	89	761	Isoamylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA3 PE=1 SV=2
B9G434	9.34e-74	20	592	108	760	Isoamylase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA3 PE=2 SV=1
D0TZF0	4.86e-73	20	584	104	755	Isoamylase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA1 PE=1 SV=1
P0A4Y5	1.19e-72	20	613	27	717	Glycogen operon protein GlgX homolog OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=glgX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001004_00631.