CAZyme Information: MGYG000001004_02131

Basic Information

• Species: CAG-56 sp900539525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900539525
• CAZyme ID: MGYG000001004_02131
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	MGYG000001004_72|CGC1	69585.3	6.1454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001004	2903340	MAG	Austria	Europe

• Gene Location: Start: 8822; End: 10627 Strand: -

Full Sequence      

MNIKSMTKRLTFYNLKKGFLYLKRYGVRDFLVRLKERFADSEVDYDKWIRARVLGEEQKK
LQRTRKWAHEPLISVIVPVYRTKECFLRQMIESVQAQTYEKWELCIADGSGEDSGPERVI
REYMEKDPRIRYERLKKNEGIAGNTNAAFAMASGEYVALFDHDDLLEPDALYEIADAIES
QHSPDMLYTDEDKVSADLDEFFQPNFKPDFNLDLLRANNYICHLLVVRRGLLLLAGGQDS
AFDGAQDYDFIFRCAEKAERIVHIPKVLYHWRVHAASTADNPFGKDYALESGKRAIEAHL
KRCSLKAEVSMLNYRGFYRVKYEVSGEPLVSIIIPNKDEIETLKRCLTSIREISSYRNYE
ILIVENNSTEKETFEFYRKIDGKDNIHVIYWKREFNYSAINNFGAAHAKGEYLILLNNDV
TVITPDWIEEFLGHCQRPEVGITGARLYFPDDTIQHAGIVMGIGGCAGSMFVGMKRAFTG
YMHRAILQQDMSAVTAACLMVKREVFEKIHGLDENLAVAFNDVDFCLRAGEAGYLVVYDP
YVEMYHFESKTRGYEDTEEKKQRFEREKAYLCSRWEGMLKAGDPCYNKNLSLRTCDYSIQ
P

Enzyme Prediction     

No EC number prediction in MGYG000001004_02131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	74	181	1.1e-26	0.6235294117647059
GT2	331	509	9e-26	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.17e-98	71	273	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.58e-40	332	548	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.29e-30	326	575	1	241	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.87e-26	74	179	1	104	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	9.21e-23	331	506	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99393.1	8.87e-266	8	601	13	606
QIB58022.1	1.26e-265	8	601	13	606
QMW77454.1	1.26e-265	8	601	13	606
AWY98933.1	4.98e-263	6	601	11	607
QQQ92271.1	2.60e-260	6	601	11	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	1.57e-15	71	306	375	604	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.57e-15	71	306	374	603	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
3BCV_A	4.48e-10	71	169	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.69e-144	65	599	360	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.68e-101	41	600	289	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	3.96e-15	70	273	7	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q4UM29	4.71e-15	71	419	14	381	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q8L0V4	9.39e-15	71	306	432	661	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001004_02131.