CAZyme Information: MGYG000001005_01351

Basic Information

• Species: Faecalimonas sp900550235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp900550235
• CAZyme ID: MGYG000001005_01351
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		67184.06	4.8489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001005	2260829	MAG	Austria	Europe

• Gene Location: Start: 34512; End: 36230 Strand: +

Full Sequence      

MKRKILTWTENEKKVESSLVELGKGVYEYTYEIPETGEEEILCLEWYEDISNTVGCWYPD
CRYERAYGADWQRQRKTTLSISAPVYCLYDQRGNNCITIALSEAVREVEWKIGVHEEDGR
FLFRCKIHMGRGKKEVKLYINETKNFYSEILKSVQMWWSDRCKILPAIVPKSAKLPFYST
WYSYHQNVEEKQLERECELASAMGFKGIIVDDGWQTEDTNRGYAFCGDWEPAQKKFPHMK
EHVAYVHSLGMKYMLWVSIPFIGKSSKIWEKFSDKLLEYQEDMHAGVADIRYKEVREYLM
EQYIDLVKRYDLDGLKMDFIDEFYEGASTPKYNEKMDFRDVQDALEYMMVELYKKLYEFK
SDILIEFRQKYVGPYIRKFGNILRVDDCPMSQLANRVGLVDLRILSGNTAVHSDMVMWNP
QETPEGVAVSLQHCFFGTLQLSVCLEECDKEVLEVIRYYMELAKEWIEERLEGDFIAEHP
EQLYPIIYGEKGKRAVVGVYEEDKVVSVKDSWEEALILNATKEKCMYLDLMQTEGKRIVI
KDCKGNIIETMDEKQYGILKLEIPSGGMVNLS

Enzyme Prediction     

No EC number prediction in MGYG000001005_01351.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.81e-58	178	465	6	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	4.47e-16	176	462	3	293	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.78e-12	180	366	47	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	3.16e-10	180	366	298	481	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	9.02e-10	178	253	5	82	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31288.1	1.01e-160	15	572	17	584
QJU17504.1	1.17e-151	38	569	47	582
BBI31507.1	1.66e-144	6	571	22	592
QOV11148.1	1.11e-140	44	569	49	583
QWH11404.1	1.21e-139	44	569	48	582

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43467	4.91e-11	179	346	336	511	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q5ARP5	9.30e-06	179	318	331	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997733	0.002269	0.000007	0.000003	0.000002	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001005_01351.