CAZyme Information: MGYG000001007_01539

Basic Information

• Species: Intestinibacter sp900540355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Intestinibacter; Intestinibacter sp900540355
• CAZyme ID: MGYG000001007_01539
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000001007_35|CGC1	56178.17	4.5727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001007	3037076	MAG	Austria	Europe

• Gene Location: Start: 62; End: 1534 Strand: -

Full Sequence      

MSKLPKDFLWGGAFAAHQFEGGWNEGGKGPSVVDVLTAGAHGVPREITQTVEEDKFYPNQ
VASDFYHRYKEDIKLFAGMGLKCLRTSIAWTRIFPNGDELEPNEEGLKFYDDVFDELLKY
GIEPVITLSHFELPLHLAREYGGFRSRKVVDCFERFAKVCFERYKNKVKYWMTFNEINNQ
MDTGNPLFFWTNSGVVVEEGEDPKAVLYKVAHNELLASAKAVIAGKEINPEFKIGCMVSH
VPIYPYSCNPDDVMAAEEAMRQRYFFADVHCRGHYPSYALKEFEREGYDIGMEEGDAEIL
AKGTVDYVGFSYYMSTTVKSDVHNENTGDIVNGALSNGVENPYIESSDWGWAIDPVGLRY
ALNRFYDRYELPLFIVENGFGAVDKVSEDGKIHDQYRIDYLKKHIEQMELAVNYDGVDLM
GYTPWGIMDLVSFTTGEMKKRYGMIYVDRDNEGNGTMERSCKDSYYWYKQVIKSQGEDLE
FEPEKEEVFA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	476	9.1e-156	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	479	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	480	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	479	5	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	482	1	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	480	6	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPJ84934.1	0.0	1	479	1	479
QCI85611.1	9.99e-306	4	479	3	478
AXI30311.1	5.42e-298	1	479	1	479
QSF35148.1	7.70e-298	1	479	1	479
AKP78401.1	1.55e-297	1	479	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.74e-244	4	479	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	8.70e-231	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.49e-230	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	5.68e-222	2	479	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	2.82e-203	4	480	11	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	9.88e-295	1	479	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	9.51e-244	4	479	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	4.98e-186	3	479	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	3.20e-178	1	480	1	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	7.68e-174	3	480	6	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001007_01539.