CAZyme Information: MGYG000001007_01885

Basic Information

• Species: Intestinibacter sp900540355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Intestinibacter; Intestinibacter sp900540355
• CAZyme ID: MGYG000001007_01885
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179		20910.97	5.4119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001007	3037076	MAG	Austria	Europe

• Gene Location: Start: 5591; End: 6130 Strand: -

Full Sequence      

MKKKLILILFIIIVLGAALYIGKDEVYKYLYPKKYSDYVEFYSKEYNIDEDLVYSIIKAE
SKFKKDAVSRRGAKGLMQIGDGTRDWAMEELDIKDADIFEPEDNIRIGCWYLNKLYREFG
DIDLVIAAYNGGSGNVKKWLADEAYSQDGENLHTIPFKETSAYVEKVKHNYEMYKKIYN

Enzyme Prediction     

No EC number prediction in MGYG000001007_01885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	49	175	3.8e-31	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.98e-69	32	173	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.50e-45	30	177	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.74e-38	50	172	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.42e-33	17	179	121	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	4.92e-31	37	172	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK99408.1	2.41e-85	1	178	1	178
AVD40846.1	2.41e-85	1	178	1	178
QQY50391.1	2.41e-85	1	178	1	178
QQY75444.1	2.41e-85	1	178	1	178
QQY70836.1	2.41e-85	1	178	1	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.70e-19	27	174	408	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.71e-19	27	174	412	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.72e-19	27	174	422	569	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	2.72e-19	27	174	418	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	2.73e-19	27	174	428	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	9.68e-18	31	167	476	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	3.88e-16	31	167	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.88e-16	31	167	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O64046	1.13e-15	31	171	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.13e-15	31	171	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.796395	0.169066	0.032412	0.000410	0.000254	0.001460

TMHMM  Annotations     

start	end
5	22