CAZyme Information: MGYG000001008_01339

Basic Information

• Species: Clostridium_AQ sp900552125
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp900552125
• CAZyme ID: MGYG000001008_01339
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881		97950.1	4.2752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001008	3113530	MAG	Austria	Europe

• Gene Location: Start: 51145; End: 53790 Strand: -

Full Sequence      

MLCQESRLLYFEWQVSMQSKKKKSDTMQHKKKKNWFRNLLVVVVSLILVGGVSLFFMLIT
VISSLDVSNLSDKLVNRQPSLLYAADGSVFYEWGGENRENVTYEQIPQSTIDAFLAIEDS
RYFSHNGFDLPRFISSAFNNLKAGGFAQGGSTLTMQTIDNFIMKPEEEKAKKEGIEYSAL
EQIQRKFQEIYMSMCLENELTKEEIITKYLNEINFGYNARGIQKGAQYYFGKDVEDLNLS
ESAFLAGVINAPNSYNPYYGYDAEKNYDYYKAAIERRNDTLYQMLNHGYITETEYKLALN
TELAFQLEGGSSSTTSNDKYYDYAVQTVNEVIKLTGEDPALVPMKIYTSLDVTAQEKATE
LSSGESISFFNDDNYQIGFTVLNNQTGEIIAVSGGRGDVESTTHRTRYTEEKSTGSTIKP
ILDYALTFDKLGWATSRVMEDKDLDLPGWSLQNSDGKFYGKVSLERALSKSLNTIAVQSL
QALIDSEGTNAMIQYLKDAGFSEDVANQFNLQYAIGGSEMKASTTQMAAAYAALANGGYY
IEPHMVTKVEYQDGSKTFENQPKKTQIMSEQAAYMMSDLLYEVVNGQYKNENLIGFLGFG
AYPVYGKTGTSDWDVDGLKYGIPKMAMKDEWMVNYTSDYTIATWSGFDIAQAGAYFTMDM
INANIPGKINKAMLDTISYNSVKIQQPDGISEYGGGLIKTEWLDEAAKNNPMTVENANIT
TSKLEAAIESAKGMNADDYTEESYAALSEALANAEKVLNNSSATQEEIDEARSALESAMQ
GLIKKEEKPSTDTSSLQEALNNASIYVDTTKYASDAVTALQTAINNANSILANPESTQEQ
INQAIQNINTAIQNCVNNPITTTPPQEDSSDEDQENQAPSS

Enzyme Prediction     

No EC number prediction in MGYG000001008_01339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	87	284	5.9e-55	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.20e-126	97	648	1	502	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.80e-123	50	648	26	572	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.04e-88	50	648	19	692	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.79e-64	86	285	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	1.62e-62	95	648	144	658	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSI26123.1	0.0	51	865	37	852
QJA02652.1	0.0	51	865	37	852
QIX09371.1	0.0	51	865	37	852
ANU69519.1	0.0	51	864	37	851
ASU18048.1	0.0	51	864	37	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.60e-81	79	647	7	557	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.81e-77	73	647	10	566	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3UDF_A	1.53e-49	78	563	19	564	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	1.84e-45	77	563	19	569	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3ZG8_B	3.34e-45	196	657	3	442	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q00573	3.02e-79	73	647	46	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
P39793	1.15e-78	51	692	52	658	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	2.04e-74	51	647	28	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	7.39e-74	51	647	28	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
A7FY32	2.35e-63	51	704	28	700	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999966	0.000059	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
39	61