CAZyme Information: MGYG000001012_00108

Basic Information

• Species: Porphyromonas sp900539155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900539155
• CAZyme ID: MGYG000001012_00108
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001012_1|CGC1	39193.7	7.9852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001012	2045709	MAG	Bangladesh	Asia

• Gene Location: Start: 123328; End: 124347 Strand: -

Full Sequence      

MNRPDLAIVVLNWNGRKLLEEYIPPLVAHTPPEMADLVVIDNGSTDDSLAYLQEAFPQVN
LVRLSENYGFAGGYNRGLRQLDYSYYCLLNSDVRVSPHWCDRPLALLRKGLAAVQPKLRS
DRQPEAFEYAGAAGGELDRWGYPFCRGRLFDTVELDHGQYDEECEILWATGACYFVSSET
FWRVGGFDESFFAHMEEIDLSWRLWLAGGRILYTPDSIVYHLGGATLEMGSPRKSYLNFR
NNLRMLYKNLPTRHAHRRLLLCRLPLDLLAAFTFLVKGQPRHATAVLRAVRDFYRTRRQL
ALSADQPWYQPTATPPIAHYSLLWQYHLRRRRTYDQLPS

Enzyme Prediction     

No EC number prediction in MGYG000001012_00108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	14	246	2.1e-23	0.8101694915254237

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	6.43e-48	8	223	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.04e-47	2	251	1	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	1.09e-15	7	246	1	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04185	GT_2_like_b	1.82e-15	9	245	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	5.89e-15	8	213	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12850.1	2.96e-242	1	338	1	338
ATS09539.1	2.79e-125	7	338	4	336
ATS04312.1	7.96e-125	7	338	4	336
ALA94644.1	1.13e-124	7	338	4	336
ATS06830.1	2.27e-124	7	338	4	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2D7I_A	3.18e-06	4	222	112	338	Crystalstructure of pp-GalNAc-T10 with UDP, GalNAc and Mn2+ [Homo sapiens],2D7R_A Crystal structure of pp-GalNAc-T10 complexed with GalNAc-Ser on lectin domain [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	6.54e-14	6	221	5	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	6.54e-14	6	221	5	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
Q8IA42	1.50e-09	4	245	178	429	N-acetylgalactosaminyltransferase 4 OS=Drosophila melanogaster OX=7227 GN=Pgant4 PE=1 SV=3
Q50864	4.25e-08	4	236	574	808	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
D4GU63	8.20e-07	5	203	19	205	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001012_00108.