CAZyme Information: MGYG000001012_00324

Basic Information

• Species: Porphyromonas sp900539155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900539155
• CAZyme ID: MGYG000001012_00324
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000001012_4|CGC1	35554.84	5.0215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001012	2045709	MAG	Bangladesh	Asia

• Gene Location: Start: 16341; End: 17279 Strand: -

Full Sequence      

MRTVTLALWCAVLLGVVYYFAVVYRVPEGGTSTPSQGWVARSPEWHDVPIADVGAGEEYE
LLEQYSELVALDFLLPYDSLFPWRVVLKEMASLEEEEEDDEVEEKVQPQKATSPSTPRTT
HPQSTRQPGIVSDWDHLFRKYGDKYGWDWWVLAAIAYQESQFRPEVVGAGGATGLMGIMP
ATGRRYGYSRAQLKQAETSLRIACMALRDFGRAFAHIPDREQRMKFTLASYNAGSAHVLD
ARRLAERDGLDPDQWDDVVEIYMGRLDEPKYYNDPLVRHGRANGDHTVRYVSEVFTRAHT
YKNKEQQHATAE

Enzyme Prediction     

No EC number prediction in MGYG000001012_00324.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	147	307	6.4e-22	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.94e-69	138	303	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	2.96e-31	134	294	271	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	2.55e-28	133	291	289	440	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	4.86e-17	137	255	9	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.36e-14	138	245	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	3.02e-138	1	312	20	331
QUT95443.1	1.41e-49	129	304	285	460
ABR42795.1	1.41e-49	129	304	285	460
QCY56220.1	1.41e-49	129	304	285	460
QUT54072.1	1.41e-49	129	304	285	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.78e-17	138	294	263	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.84e-17	138	294	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.84e-17	138	294	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	2.64e-17	138	294	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.64e-17	138	294	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	1.37e-21	137	294	292	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A1U3J1	1.96e-20	137	294	289	441	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q9KTN5	5.29e-20	134	294	301	454	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltF PE=3 SV=1
A5F353	5.29e-20	134	294	301	454	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=mltF PE=3 SV=1
A8ZWR8	7.39e-20	137	304	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.977283	0.022410	0.000161	0.000034	0.000028	0.000100

TMHMM  Annotations     

start	end
5	24