CAZyme Information: MGYG000001015_00222

Basic Information

• Species: Gemmiger sp900556255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900556255
• CAZyme ID: MGYG000001015_00222
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
145		15952.18	4.3921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001015	1427844	MAG	United Kingdom	Europe

• Gene Location: Start: 21; End: 458 Strand: +

Full Sequence      

MRLVLIGGGEMGYVEKMRDLAQELSLGRSVIFAGVRSDVPALYDAMDAFVLPSLFEGLPV
VLVEAQCAGLPCFVSDTVDPDAAFTDRLHFLPLNDDAAWVSAISRESFARDADAPQKARA
AGYDIRTTAEFLQNFYLRRYKEATP

Enzyme Prediction     

No EC number prediction in MGYG000001015_00222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	2	79	3.8e-17	0.48125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	4.96e-34	2	125	224	350	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03808	GT4_CapM-like	1.11e-21	2	130	222	345	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03807	GT4_WbnK-like	1.79e-21	2	142	223	359	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03811	GT4_GT28_WabH-like	6.00e-20	2	142	221	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam13692	Glyco_trans_1_4	3.94e-19	2	105	35	134	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO73931.1	4.87e-28	2	143	231	380
QNL46283.1	4.87e-28	2	143	231	380
QUO36422.1	6.14e-28	3	142	214	353
AIW44586.1	6.44e-28	3	143	240	382
ALO73939.1	6.44e-28	3	143	240	382

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	5.48e-14	2	136	237	374	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
Q04975	1.77e-07	2	71	431	498	Vi polysaccharide biosynthesis protein VipC/TviE OS=Salmonella typhi OX=90370 GN=vipC PE=4 SV=2
O05083	5.41e-07	3	71	215	281	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q59002	2.59e-06	2	75	240	313	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001015_00222.