CAZyme Information: MGYG000001015_00706

Basic Information

• Species: Gemmiger sp900556255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900556255
• CAZyme ID: MGYG000001015_00706
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000001015_76|CGC1	55607.8	4.6794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001015	1427844	MAG	United Kingdom	Europe

• Gene Location: Start: 2531; End: 4045 Strand: +

Full Sequence      

MAQFVKLNPETLQQLRVVDARLVSYDVEMAEVTGGTFWRAYTPAQIAGEEEFELKKGTGG
QMMNKNALMQYYDSINLYDEKLRKLAKEIGPAWVRVSGTWATKTYYDFDGHTGGTAPEGY
DAVLTREQWLGVLDFCKEIGAKLLISVADCDGLHHADAPWNPSQAEQIFALSKEYGMPID
AAEFVNEPHMLEISGCPKGYTSELFAKNHDVFARWLRENYPDCLLVGTSASDGMPVTDPT
YKSDKPSFNFMPTVPLDSLMQPMQEKLDVFSYHYYNGVSERLKAVMPANYWKPDRALSED
YLAVAGNLARLHAEKRDTYCPGAQMWVTESGDAGGGGTTWASTYQDVFRTLNELGSFPTV
TDGIIFHNTLASSDYGYLSHTVFDPRPNYFAVLLWNRIMGTTVYDAAEPIREGAHVYAHS
RADGKPGAAYLVINNSKTDAATVSLPKAAEVYQLSAETLRADTMLCNGKPLVLGEGNTLP
EMAPVTAPAGELTLPAATCTFIVL

Enzyme Prediction     

No EC number prediction in MGYG000001015_00706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	76	504	3.6e-66	0.9384615384615385

CDD Domains     

MGYG000001015_00706 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	5.73e-229	1	504	1	509
SNU86930.1	1.80e-210	1	504	1	507
AXI08463.1	2.03e-206	1	504	1	504
QGS68324.1	2.03e-206	1	504	1	504
QTH47273.1	3.14e-202	1	504	1	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	7.71e-09	143	504	16	378	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5LA4_A	1.35e-08	75	504	39	500	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
5E8M_A	1.32e-07	143	504	18	380	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5L9Z_A	3.07e-07	143	504	18	380	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L608	1.96e-14	74	485	71	510	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
Q9LRC8	2.79e-10	266	485	272	492	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
B2RY83	3.80e-09	317	504	369	581	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1
Q8WWQ2	3.80e-09	317	504	369	581	Inactive heparanase-2 OS=Homo sapiens OX=9606 GN=HPSE2 PE=1 SV=3
Q9FZP1	4.68e-09	74	485	75	507	Heparanase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g34940 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001015_00706.