CAZyme Information: MGYG000001015_00728

Basic Information

• Species: Gemmiger sp900556255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900556255
• CAZyme ID: MGYG000001015_00728
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000001015_80|CGC1	35918.12	5.1109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001015	1427844	MAG	United Kingdom	Europe

• Gene Location: Start: 2070; End: 3041 Strand: -

Full Sequence      

MQERKTIVIAADGSGDFATLTAAVQAQQADAQQPVRFYIKKGIYRERPFIELADYCLQGE
SRTETVFTAGVGGRDPWPGEEKTGTFRSYTLFLGGRRAEVRDLTVENTAGDGVKAGQALA
VYADAARVYMENVTLLGNQDTLFTAPLPEQEREKNGFRGPRQDTPRLDTVQYYRNCTIRG
NIDFIFGGANAVFDRCRIEPWNHAKPISYITAPSTPAGQPGYLFVDCTVQGNCPAGSVYL
GRPWRKDAACCWLHCRLSEEIRPDGWDNWNNPENETTARFAEYENSGRGAAAVRAFGTVN
DAETLQKQLENLTALRTMFDVQV

Enzyme Prediction     

No EC number prediction in MGYG000001015_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	295	1.2e-72	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.23e-51	36	303	112	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	5.31e-40	1	290	1	270	pectinesterase
pfam01095	Pectinesterase	8.17e-39	7	290	2	266	Pectinesterase.
PLN02416	PLN02416	3.39e-37	5	294	230	500	probable pectinesterase/pectinesterase inhibitor
PLN02671	PLN02671	5.06e-36	5	290	59	325	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	2.48e-85	6	290	3	285
CBL01447.1	2.48e-85	6	290	3	285
QIA44050.1	7.74e-85	7	290	4	285
ATP00222.1	7.74e-85	7	290	4	285
AXA81880.1	6.84e-84	6	291	3	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.74e-28	7	291	9	274	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.63e-24	8	290	6	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.00e-22	8	291	34	336	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	2.29e-20	17	306	18	327	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	4.65e-18	17	306	18	327	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O49006	1.10e-31	9	307	284	568	Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=PME3 PE=1 SV=2
Q9FF78	8.28e-31	1	291	252	519	Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana OX=3702 GN=PME46 PE=2 SV=1
Q9LVQ0	8.99e-31	1	292	1	272	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43043	1.30e-30	9	291	61	325	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q43062	2.15e-30	8	290	210	474	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001015_00728.