CAZyme Information: MGYG000001017_01288

Basic Information

• Species: Lactococcus garvieae_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus garvieae_B
• CAZyme ID: MGYG000001017_01288
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24376.58	5.3295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001017	1758548	MAG	Bangladesh	Asia

• Gene Location: Start: 104; End: 742 Strand: +

Full Sequence      

MTYQQKRRVLSTKSRTLLRFIVQVLTILFVIVDLLAFTTLHPADHRDATELAVQVETNRE
YDFIRTIVPYAQETQQKYGILASLTLGQAALESDFGRSGLAAKYHNLFGIKAYGDVPKVF
LETKEFENNAWTTVREPFRVYEDWKQSVEGHAYLFTEGTTWNPNQYALVLAAQDYKEAAH
AVQLSGYATDPAYTERLLEIIENYGLFEYDKI

Enzyme Prediction     

No EC number prediction in MGYG000001017_01288.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	68	206	2.8e-34	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.80e-61	28	212	12	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.85e-36	62	210	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	9.71e-34	55	211	315	473	amidase domain-containing protein.
NF038016	sporang_Gsm	1.98e-29	62	210	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
TIGR02541	flagell_FlgJ	9.25e-29	62	201	150	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK60448.1	4.91e-125	1	211	20	230
QSQ99418.1	4.91e-125	1	211	20	230
BAK58565.1	4.91e-125	1	211	20	230
QSQ97548.1	5.57e-125	1	212	94	305
BAK60757.1	9.24e-100	1	212	10	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.70e-19	45	210	15	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.27e-17	55	210	55	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	6.67e-15	63	206	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	8.03e-15	63	206	5	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	1.27e-14	62	202	5	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.73e-39	48	212	29	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	2.49e-21	63	210	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	4.91e-20	49	210	51	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	9.12e-20	49	210	51	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	2.34e-19	49	210	51	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42