CAZyme Information: MGYG000001021_00929

Basic Information

• Species: Ruminococcus_C sp000980705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
• CAZyme ID: MGYG000001021_00929
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		53494.6	6.4129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001021	2360136	MAG	Sweden	Europe

• Gene Location: Start: 13703; End: 15121 Strand: +

Full Sequence      

MKILFAASEALPFAASGGLADVAGSLPAALSKNSEIDCRVVMPLYRSVTPAVRNKMTYLK
DITVEVGWRKQYCGIYTIQVGKVTYYLLDNPYYFMRDGMYGFYDDCERFVFFSRAVLEIL
PALDWKPDIIHCNDWQTAMVPVFYRVLYQYHQEFENIRIIYTIHNIQYQGVYGKEVVTEL
MGIPTYHTSLLEFDGMVNLMKGAIETADRVTTVSPTYAKEILDPWYSYGMDRALVRRQDG
IVGILNGIDVVGYDPETDSNLKKHYSVTKIAGKKECRAALLHECGLTDSDAPVVGIVTRF
VAHKGIQLVQQTFQEMLQLGCRFVVLGSGERLYEDFFREMQAEYPDQVHVTVGFVPAMAR
RIYGGADIFLMPSQNEPCGLAQMVAMRYGTIPVVRETGGLKDSVFDAGGKNGNGFTFKTY
DAYDMLDAVKRACELFADKRKWNALVRHAMKCDYSWNVSAEKYVELYRSLLG

Enzyme Prediction     

No EC number prediction in MGYG000001021_00929.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	468	8e-175	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	469	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	472	1	465	glycogen synthase GlgA.
TIGR02095	glgA	0.0	1	470	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	7.96e-179	1	472	1	480	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14098	PRK14098	1.85e-117	2	472	7	488	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05864.1	2.57e-219	1	470	1	469
ADU20805.1	8.48e-213	1	470	1	469
QNO18264.1	2.09e-195	1	471	1	472
CBK95754.1	5.02e-194	1	472	1	473
CBL34072.1	4.09e-193	1	472	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	8.67e-92	1	470	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	2.16e-91	1	470	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.69e-90	1	470	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.09e-83	1	467	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	1.50e-78	2	467	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6TSC8	1.38e-157	1	470	1	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q816G8	2.27e-151	1	471	1	475	Glycogen synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=glgA PE=3 SV=1
B7HBC4	4.56e-151	1	471	1	475	Glycogen synthase OS=Bacillus cereus (strain B4264) OX=405532 GN=glgA PE=3 SV=1
Q6HC18	5.22e-150	1	471	1	475	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
B9J2G5	1.05e-149	1	471	1	475	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999199	0.000840	0.000002	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001021_00929.