CAZyme Information: MGYG000001021_00968

Basic Information

• Species: Ruminococcus_C sp000980705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
• CAZyme ID: MGYG000001021_00968
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000001021_17|CGC2	61653.26	6.556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001021	2360136	MAG	Sweden	Europe

• Gene Location: Start: 47537; End: 49120 Strand: -

Full Sequence      

MHGRNCRRTDTANRKRRKKVCFLRYIGKEYVPLFGTVDWIMKNILFAASECVPFIKTGGL
ADVVGALPKSLDRSEYDVRVIIPNYTCIPWEYRSQFRYVSHFYMDYGRHVENVHVGIMEY
VYEGVHFYFIDNEYYFKCDRPYSDSTQWDIERFIFFSKAVLAAMPVIGFHPDIIHCHDWQ
TGMIPVFLKSTFATHSFYWGTKSIMTIHNLKFQGVWDIRHFVYNTNLPDYMFTPDKLEFK
SDANMLKGGLVYADYITTVSETYAEEIKTPYYGEQLDGLLCARSRSLRGILNGIDYEVYN
PQTDKKIDVHYSVKDAVEKKKQAKLALQKELGLPEDENKFMIAIISRLTDQKGLDLVDWI
ADRITDEFTQFVIIGTGEARYENMFRYYQNKYPDRVSANIFYSDPLAHKLYAAADAMLVP
SRFEPCGLTQLISLRYGTVPIVRETGGLKDTVVPYNEYEKTGTGFTFAHYNADDLLYTIN
YAKKIYFDHREDWDDIVRRGMEQDFSWSSSALQYQGMYDWILRGMVD

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	43	518	6e-180	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	43	518	2	470	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	43	523	2	465	glycogen synthase GlgA.
COG0297	GlgA	0.0	43	524	2	481	Glycogen synthase [Carbohydrate transport and metabolism].
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	43	518	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	3.83e-122	44	518	6	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH70303.1	1.46e-240	41	519	1	478
QUO21972.1	3.04e-240	41	522	1	481
ADZ84828.1	6.84e-239	41	519	1	478
AEN96679.1	1.54e-233	41	522	1	481
CBL09256.1	6.95e-232	41	522	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	2.11e-84	43	518	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.69e-84	43	518	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.85e-83	43	518	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	1.56e-82	43	522	2	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
1RZV_A	2.77e-79	43	522	2	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	3.53e-222	41	519	1	476	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	1.17e-203	41	519	1	476	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
B7GK04	6.49e-157	43	524	2	477	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
A4J4I4	8.45e-154	43	522	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
B2TR28	4.14e-151	43	518	2	472	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40