CAZyme Information: MGYG000001021_01303

Basic Information

• Species: Ruminococcus_C sp000980705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
• CAZyme ID: MGYG000001021_01303
• CAZy Family: GH44
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	MGYG000001021_24|CGC1	91812.17	3.9607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001021	2360136	MAG	Sweden	Europe

• Gene Location: Start: 13679; End: 16234 Strand: +

Full Sequence      

MKKRILAGLTASVLAAACAAQIPSILSVSAAGSYDIQLKIQLDGEKKAISPYIYGVNESG
NSGSLKSVKTNAVRQGGNRFTGYNWETNYSNAGEDWVNSSDTHMGDVSDGPAYQAHQLSK
ECTEQGIGYKMATLQMAGYVAADKNGTVTDSEAAPSSRWNKVAFQKDGALSDTPDLTDDT
VYMDEYVNYLIQNLGDSTTSTGIQGYNLDNEPVLWNDTHPLLHKDEVSNQELVSKSIALS
KVVKSLDPNAEIYGPAFWGILPCYQAGNGDNYSDPDWEAVKSQYSWYMDYYLKQMADAEK
ENGMRLLDVVDVHYYAQDCSTDDGILQAARSLYDPDYKENSWLSQWFGSSFPFLTRMQES
IDKYYPGTKLALTEYNLANIADEDNTGKSVVSAIAETEALGAFADQGVYLATYWGTLSKC
PYVTSAINLYTNYDGKGSDFGDTLVESSSPDLSKAAIFASIDGSDDGKVTAVVSNKDKEN
TEKAVISLDGTDTDYKSAVVYAVTQDSSDIKILDVQNDISGNQVTVELPPLSVAQVVIAD
ETTDVVIPDEPNIEVKKTTYNFSDLEKNQNGNYMIPLGDKEHLKEVILNVTATSNAGSGW
CVGGGALCFNKVVEAGSTDEVWGNKSFQYRLNTNNVSIPFDDQYTIVVDEKSTTIAGFCN
DTSAELQSWWASSEKDAASGTDITTTYNSVTLVYEYDNDKPDTTTTTPAETTDTTETLTT
TSAPETETSSSETTVSESSTESETTVSSAETTTETTTVSTETSSASEDTGTTSATTGDAD
VSVSLYGDVNLDGRVDITDAVQLNKAVAGQVKLNAQASKNADCNGDDGLDSSDATSLLRF
LTHIIDSLPEK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.151

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH44	34	539	1.5e-159	0.9922178988326849
CBM76	549	696	2.1e-48	0.9316770186335404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12891	Glyco_hydro_44	2.58e-64	90	317	1	233	Glycoside hydrolase family 44. This is a family of bacterial glycoside hydrolases formerly known as cellulase family J, and now known as Cel44A. It is one of the major enzymatic components of the cellulosome of Clostridium thermocellum strain F1 and of many other Firmicutes.
cd14256	Dockerin_I	2.25e-13	786	841	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd14253	Dockerin	8.12e-07	787	842	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
pfam00404	Dockerin_1	1.15e-05	787	841	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14255	Dockerin_III	0.009	787	840	1	59	Type III dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents the atypical type III dockerins and related domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ERJ96918.1	0.0	1	851	12	863
CAC83072.1	8.42e-206	27	850	29	808
CDD54427.1	3.00e-195	33	694	31	681
CBL16808.1	5.98e-192	33	694	31	681
AAA95959.1	2.08e-187	28	600	30	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2E0P_A	7.62e-132	36	538	10	514	ChainA, Endoglucanase [Acetivibrio thermocellus],2E4T_A Chain A, Endoglucanase [Acetivibrio thermocellus],2EO7_A Chain A, Endoglucanase [Acetivibrio thermocellus]
2EEX_A	2.13e-131	36	538	10	514	ChainA, Endoglucanase [Acetivibrio thermocellus],2EJ1_A Chain A, Endoglucanase [Acetivibrio thermocellus],2EQD_A Chain A, Endoglucanase [Acetivibrio thermocellus]
3IK2_A	1.85e-128	35	540	2	511	CrystalStructure of a Glycoside Hydrolase Family 44 Endoglucanase produced by Clostridium acetobutylium ATCC 824 [Clostridium acetobutylicum ATCC 824]
2YIH_A	1.08e-125	36	538	10	515	Structureof a Paenibacillus polymyxa Xyloglucanase from GH family 44 with Xyloglucan [Paenibacillus polymyxa],2YJQ_A Structure of a Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44 [Paenibacillus polymyxa],2YJQ_B Structure of a Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44 [Paenibacillus polymyxa]
2YKK_A	4.57e-124	36	538	10	515	Structureof a Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44 [Paenibacillus polymyxa],3ZQ9_A Structure of a Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44 [Paenibacillus polymyxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29719	3.49e-124	22	549	23	552	Endoglucanase A OS=Paenibacillus lautus OX=1401 GN=celA PE=3 SV=1
P22533	9.54e-110	36	529	788	1293	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000173	0.086545	0.913156	0.000040	0.000049	0.000040

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001021_01303.