CAZyme Information: MGYG000001021_01504

Basic Information

• Species: Ruminococcus_C sp000980705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
• CAZyme ID: MGYG000001021_01504
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764		84034.11	4.9756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001021	2360136	MAG	Sweden	Europe

• Gene Location: Start: 10426; End: 12720 Strand: +

Full Sequence      

MNIPELLQQLTLEEKAGLCSGGDFWHTKAVERLGIPAMMMSDGPHGLRKQDEQGDHMGVN
DSIKAVCFPAGCATASSFDRELVERMGKALGNECQAENVGVLLGPAVNIKRSPLCGRNFE
YYSEDPYVAGEMATYFIRGVQSQDVGTSIKHFYANNQEHRRMSSSSEMSERTAREIYLAA
FERPIRKAKPWTVMCAYNRINGVYAAENKEALTDILRGEWNFHGYVVSDWGAVNDRVADL
EAGMDLEMPSSCGMRDAEIVKAVRCGRLPESVLDRAVTRILRIVQRYLDGRRPGAVFDRD
ADHELAREIASQCMVLLKNEDHILPLDKTVPAAFIGKFAQSPRFQGGGSSHINCHKVESA
LEMAKDYPVTYAQGYETSDDVIRDDLIAEAVAAAKAAKVAVVFAGLPDIFESEGYDREHM
RLPDCQNALIEAVAAANPNTVVVLHGGSPVEMPWLGKVKGVLEAYLCGQAVGGATVQILY
GDVNPSGHLAETFPVKLEDNPSYVAYQGEGDVTEYREGVFVGYRYYATKKMPVLFPFGYG
LSYTTFAISNLRTEQDEYQSHDVMTVSVDVTNTGDRAGKEVVQLYVLPKTKTDSVQRPVQ
ELRGFEKVELQPGETKTVTFTLHGSSAFAYYCTQKKRWVVETGAYQLAAGNSSDNLTAEK
TVLIHGERALPAEITLNTTIGDILRIPGADQEIMKYAGAFGMNDSSESDSMGESTADMME
AMMRYMPVRGLLSFGGGTVSIAECKALVEKLNTLLEQANLHNRD

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	1.6e-71	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.46e-87	3	653	38	754	beta-glucosidase BglX.
COG1472	BglX	1.67e-68	22	373	47	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.04e-60	6	659	56	778	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.84e-55	314	523	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.09e-36	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18561.1	0.0	1	754	1	758
QUI21624.1	0.0	3	752	2	754
QTE73764.1	0.0	1	752	1	759
QTE69830.1	0.0	1	752	1	759
QHQ63232.1	0.0	3	752	6	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.43e-281	1	754	3	754	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.21e-196	7	740	9	736	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.49e-133	2	667	5	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.13e-130	2	667	5	839	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.12e-125	3	668	4	717	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.10e-280	1	754	3	754	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.31e-188	7	743	9	746	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.31e-185	7	743	9	746	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q0CAF5	9.36e-138	1	662	4	830	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
Q2U8Y5	9.36e-138	1	656	4	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001021_01504.