CAZyme Information: MGYG000001021_01772

Basic Information

• Species: Ruminococcus_C sp000980705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
• CAZyme ID: MGYG000001021_01772
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000001021_32|CGC1	55863.3	4.7654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001021	2360136	MAG	Sweden	Europe

• Gene Location: Start: 36959; End: 38407 Strand: -

Full Sequence      

MSNVRTINLKNACRALERSADKETRWRPAFHLSPMTGWLNDPNGLCQIGATHHVFFQYSP
FDVKPGLNYWGHYTTEDFVTYQYHEPGLCSDEKFDCHGVYSGSALEADDTLYVFYTGNVL
QRDDPDYDYITRGREHNTIRAESKDGIHFEKKEVLLYNRDYPADVTCHVRDPKVWKHGDS
YTMVLGSRRKDDVGEILVYRSSDLKDWKLANRVTSETPFGYMWECPDCFTLDGVRFLSFS
PQGVDAQDWKYNNIYQSGYCRLEGDLYGDYELKPFREFDHGFDFYAPQTYLDQQGRRILI
GWMGMPDCDYGYPEREYGWTNLLTIPRVLHQRDGRIFQEPLPELQKLRGEELHMTVQDSA
EQKTDFVYEAEILNTAGEEMEVQFGTDGRITWKDGFLSLAFGESGQNRPLRRVPLEKLEN
LRIFCDTSSIELFANDGEAVFTSRFYADAAASQLTVLSAQAEVTLWKLHPIQIENCFSNK
EA

Enzyme Prediction     

No EC number prediction in MGYG000001021_01772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	340	1.8e-85	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.39e-155	37	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	8.90e-140	26	448	13	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	7.26e-133	5	474	8	485	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	2.02e-99	31	437	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	3.45e-99	31	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ81804.1	2.14e-152	22	468	24	474
QEH67471.1	6.08e-152	22	468	24	474
CED94068.1	1.68e-146	9	475	11	482
CBL38537.1	2.05e-146	27	446	33	455
AQP38736.1	8.24e-146	27	446	33	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	4.47e-76	9	475	7	487	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.18e-75	17	448	39	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.78e-74	17	448	39	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	3.21e-57	30	471	36	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	5.93e-48	26	471	2	430	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.04e-96	27	468	29	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	7.85e-91	16	448	29	455	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P16553	3.84e-89	15	468	11	475	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
Q05936	8.38e-86	23	465	30	482	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
A1STJ9	2.30e-85	19	455	88	523	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001021_01772.