CAZyme Information: MGYG000001024_00116

Basic Information

• Species: HGM11521 sp900751885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11521; HGM11521 sp900751885
• CAZyme ID: MGYG000001024_00116
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1099	MGYG000001024_4|CGC2	122684.24	4.5295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001024	2614111	MAG	Sweden	Europe

• Gene Location: Start: 110379; End: 113678 Strand: -

Full Sequence      

MKKILAYTLALSMLLSVLSPALLASAQETFIVPESPSGDYNMNPDWKFSKPTGVKWPLAE
AQETSKDAQGRIFYDPAFDDSSWDDVSLPHTFNDEDSFRSVAADPGEGGAYRGISFYRKH
FSLPAGDKGKKVIMEFEGVRQAAYVYLNGSMVGYYEYGVSPFGIDLSDTIRFGEDNVIAV
AIDNTSARGMTKTITETKPGSVPGSCDGVAFQWNTKDFNPDMGGITRNVILHVKNPVYQT
LPLYSNLKTKGTYVYAKDINVKNSSAQVYVESEVRNESDSAGDVTLEVNVVDDKGMLVSK
FASDSVQIQPAKDKDVHYQSIIPKDAYEEEPAPTETDSVETTILTAQAKIENLRLWAPDD
PYLYDVYAVLKQGDSVIDTQKVTTGFRSVEMKGGEDGGVFINGKFYWLTGYAQRSTNEWA
AIGIAPDWLRDYDAQLIKESNANYVRWMHVSAQPADIRAFDKYGIVSVQPAGDKEGDPKG
RQWDQRMEVMRDTMVYFRNSPSILFWEAGNSAVSAEHMKETTDLRKKLDPHGMRAAGSRS
LSEQQAVDESEYVGTMLGRNVWDGKQFTDNGKESRDKRVIIETEYHREESPRRVWDDYSP
PDFDYINVYSGGSKVSYKDTYDLNAEDFILSDAQSYNEFYQSRMQANSATPFYSAAAALC
WSDSNQHGRQQASENARMSGRVDPVRIKKQSFYAYQVMQSEEPALYLVGHWNYPEDPNAY
QYPVRDEKTYEYTGETALRNPKDKTVYVVASHCARVDLLVNGEVKGSDTQPDNGFIYAFE
HIDITQHGQIEAVSYDGAGKELARQKIETVGEPQQIRLTPVTGPDGFRADGSDIAYIDVE
ICDAQGRVCPLDYERIDFEVTGPAEMLGGYNSGVKDLGHSNDYVYAECGTNRIFLRAGRD
AGAIKVTAKRSGMQPVSIVLNTKEFQTENGLTKVMPQVRSVETPVRPPQQETPKTIPQRL
SNVFDVLFGINTGTKQEQNQDTTIEVLVNDRKIEGLDAYRMVGLYGEIFKVLDAVGAEYT
YDQEKKELTASANGNTIVTSVKNSEMLVNGQPSIINDWPEEKNGTLYAEISAILDNLGYQ
TYWDGDVYHVQNGGGESNE

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	40	585	2.5e-72	0.5279255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.60e-23	76	530	44	425	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	8.66e-22	89	530	48	441	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	5.30e-16	816	919	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	8.69e-16	117	530	113	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	8.35e-13	80	236	20	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA20342.1	3.41e-302	40	1077	11	1070
QGH35456.1	5.05e-302	40	1077	19	1079
AGT88372.1	7.17e-235	40	932	3	801
ADJ49535.1	7.17e-235	40	932	3	801
QMV17606.1	8.96e-226	20	937	30	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	8.47e-181	29	938	27	820	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
4YPJ_A	4.34e-53	41	913	11	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	2.02e-50	41	922	5	801	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
7RSK_A	1.97e-43	77	924	28	779	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	4.54e-43	77	920	28	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	3.60e-180	29	938	18	811	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	9.73e-37	78	923	27	724	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
A7LXS9	1.26e-36	35	925	40	851	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.16e-31	79	996	71	893	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	5.68e-22	77	766	73	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999101	0.000175	0.000177	0.000142	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001024_00116.